KEGG   Ursus arctos horribilis: 113260281
Entry
113260281         CDS       T05909                                 

Gene name
CCL19
Definition
(RefSeq) C-C motif chemokine 19
  KO
K05512  C-C motif chemokine 19
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04062  Chemokine signaling pathway
uah04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    113260281 (CCL19)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113260281 (CCL19)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113260281 (CCL19)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    113260281 (CCL19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113260281 (CCL19)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Chemokines
   113260281 (CCL19)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 113260281
NCBI-ProteinID: XP_026361774
UniProt: A0A3Q7X5H6
LinkDB
Position
Unknown
AA seq 100 aa
MASQAAALLALSLLSLWTSPALGGANDAEDCCLSVTQRPIPGNIVRAFRYLLIKDGCRVP
AVVFTTLRGHQLCAPPDQPWVDRIIRRLQKNSAKNKRHSG
NT seq 303 nt   +upstreamnt  +downstreamnt
atggcatcccaagcagctgcactcctggccctcagcctgctgagtctctggacctcccct
gctctgggcggtgccaatgatgccgaagactgctgcctgtctgtaacccagcgtcctatc
ccagggaatatcgtgagagcctttcgctacctcctcatcaaggatggctgtagagtgcct
gctgttgtgttcaccacactgaggggtcatcagctctgtgcacccccagaccagccctgg
gtggaccgcatcatccggagactgcagaagaactctgcaaagaacaagcgccacagcggt
tag

KEGG   Ursus arctos horribilis: 113260498
Entry
113260498         CDS       T05909                                 

Gene name
CCL21
Definition
(RefSeq) C-C motif chemokine 21
  KO
K16062  C-C motif chemokine 21
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04062  Chemokine signaling pathway
uah04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    113260498 (CCL21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113260498 (CCL21)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113260498 (CCL21)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    113260498 (CCL21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113260498 (CCL21)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Chemokines
   113260498 (CCL21)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 113260498
NCBI-ProteinID: XP_026362110
UniProt: A0A3Q7WB51
LinkDB
Position
Unknown
AA seq 137 aa
MAQSLPLSLLVLVLAFCIPWTQGSDGGAQDCCLKYSLRKIPARVVRSYRKQEPSLGCPIP
AILFSPRKRSQPELCADPKETWVQQLMQRLDQPPAPQKPVQGCKKDRGAPKSGKKGKGSK
GCKRTEQPQAPKGSVAQ
NT seq 414 nt   +upstreamnt  +downstreamnt
atggctcagtcactgcctctgagcctccttgtcctggtcctggccttctgcatcccctgg
acccaaggcagtgatggaggggcacaggactgctgcctcaagtacagcctaaggaagatt
cccgcccgggttgtccgaagctaccggaagcaggagccaagcttgggctgccccatcccg
gctatcctgttctcacctcggaagcgctctcaaccagagctgtgtgcagaccctaaagag
acctgggtgcagcagctgatgcagcgtctggaccagccaccagctccacagaaaccagtc
cagggctgtaagaaggacagaggggctcccaagtctggcaagaagggaaagggctccaaa
ggctgtaagaggactgaacagccacaggccccaaaagggtctgtagcacagtga

DBGET integrated database retrieval system