KEGG   Ursus arctos horribilis: 113260290
Entry
113260290         CDS       T05909                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04217  Necroptosis
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04623  Cytosolic DNA-sensing pathway
uah04630  Jak-STAT signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah05152  Tuberculosis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113260290
   04151 PI3K-Akt signaling pathway
    113260290
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113260290
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113260290
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113260290
   04621 NOD-like receptor signaling pathway
    113260290
   04622 RIG-I-like receptor signaling pathway
    113260290
   04623 Cytosolic DNA-sensing pathway
    113260290
   04650 Natural killer cell mediated cytotoxicity
    113260290
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113260290
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113260290
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113260290
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113260290
   05162 Measles
    113260290
   05164 Influenza A
    113260290
   05161 Hepatitis B
    113260290
   05160 Hepatitis C
    113260290
   05168 Herpes simplex virus 1 infection
    113260290
   05163 Human cytomegalovirus infection
    113260290
   05167 Kaposi sarcoma-associated herpesvirus infection
    113260290
   05169 Epstein-Barr virus infection
    113260290
   05165 Human papillomavirus infection
    113260290
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113260290
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interferons
   113260290
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 113260290
NCBI-ProteinID: XP_026361780
UniProt: A0A3Q7WAA5
LinkDB
Position
Unknown
AA seq 187 aa
MALPFSFLVALVVLSGNSLCSLGCDLPQNHGLFAWRALTLLGQMKRMSASSCDGYTRDFA
FPKEVVDGKQLQKAQALSVVHVMNQKIFHVFCTEPSSAAWNTTLLEEFCSGLSEQLSALE
ACPMQAARVGETPAMNVDSILRNYFQRISLYLQEKQYSPCAWETVRAEITSSLFSSTILQ
EGLRRKK
NT seq 564 nt   +upstreamnt  +downstreamnt
atggccctgcccttctccttcttggtggccctggtggtgctcagcggcaactccctctgc
tctctgggctgtgacctgcctcagaaccatggcctgtttgcctggagggccttgacgctc
ctgggacaaatgaagagaatgtctgctagctcttgtgacgggtacacacgtgactttgcc
ttccccaaggaggtggttgatggcaagcagttgcagaaggctcaagccctctcggtcgtg
catgtgatgaaccagaagatcttccacgtcttctgcacagagccctcatctgctgcttgg
aacacgaccctcctagaggaattctgctcgggactttctgagcagctgagcgccctggaa
gcctgtcccatgcaggcggcgcgagtgggagagactcccgccatgaatgtggactccatc
ctgaggaactacttccaaagaatctccctctacctgcaagagaagcaatacagcccttgt
gcctgggagactgtcagagcagaaatcacgagctccttgttttcttcaacgatcttgcaa
gaaggactaaggcgcaagaaatga

KEGG   Ursus arctos horribilis: 113260291
Entry
113260291         CDS       T05909                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04217  Necroptosis
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04623  Cytosolic DNA-sensing pathway
uah04630  Jak-STAT signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah05152  Tuberculosis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113260291
   04151 PI3K-Akt signaling pathway
    113260291
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113260291
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113260291
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113260291
   04621 NOD-like receptor signaling pathway
    113260291
   04622 RIG-I-like receptor signaling pathway
    113260291
   04623 Cytosolic DNA-sensing pathway
    113260291
   04650 Natural killer cell mediated cytotoxicity
    113260291
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113260291
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113260291
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113260291
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113260291
   05162 Measles
    113260291
   05164 Influenza A
    113260291
   05161 Hepatitis B
    113260291
   05160 Hepatitis C
    113260291
   05168 Herpes simplex virus 1 infection
    113260291
   05163 Human cytomegalovirus infection
    113260291
   05167 Kaposi sarcoma-associated herpesvirus infection
    113260291
   05169 Epstein-Barr virus infection
    113260291
   05165 Human papillomavirus infection
    113260291
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113260291
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interferons
   113260291
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 113260291
NCBI-ProteinID: XP_026361781
UniProt: A0A3Q7VL96
LinkDB
Position
Unknown
AA seq 187 aa
MALPFSFLVALVVLSGNSLCSLGCDLPQNHGLFAWRALTLLGQMKRMSASSCDGYTHDFA
FPKEVVDGKQLQKAQALSVVHVMNQKIFHVFCTEPSSAAWNTTLLEEFCSGLSEQLSVLE
ACPMQAARVGETPGMNVDSILRNYFQRISLYLQAKQYSPCAWETVRAEIMKPLFSSTILQ
EGLRRKK
NT seq 564 nt   +upstreamnt  +downstreamnt
atggccctgcccttctccttcttggtggccctggtggtgctcagcggcaactccctctgc
tctctgggctgtgacctgcctcagaaccatggcctgtttgcctggagggccttgacgctc
ctgggacaaatgaagagaatgtctgctagctcttgtgacgggtacacacatgactttgcc
ttccccaaggaggtggttgatggcaagcagttgcagaaggctcaagccctctcggtcgtg
catgtgatgaaccagaagatcttccacgtcttctgcacagagccctcatctgctgcttgg
aacacgaccctcctagaggaattctgctcgggactttctgagcagctgagcgtcctggaa
gcctgtcccatgcaggcggcgcgagtgggagagactcccggcatgaatgtggactccatc
ctgaggaactacttccaaagaatctccctctacctgcaagcgaagcaatacagcccttgt
gcctgggagactgtcagagcagaaatcatgaaacccttgttttcatcaacaatcttgcaa
gaaggactaaggcgcaagaaatga

KEGG   Ursus arctos horribilis: 113260293
Entry
113260293         CDS       T05909                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04217  Necroptosis
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04623  Cytosolic DNA-sensing pathway
uah04630  Jak-STAT signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah05152  Tuberculosis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113260293
   04151 PI3K-Akt signaling pathway
    113260293
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113260293
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113260293
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113260293
   04621 NOD-like receptor signaling pathway
    113260293
   04622 RIG-I-like receptor signaling pathway
    113260293
   04623 Cytosolic DNA-sensing pathway
    113260293
   04650 Natural killer cell mediated cytotoxicity
    113260293
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113260293
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113260293
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113260293
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113260293
   05162 Measles
    113260293
   05164 Influenza A
    113260293
   05161 Hepatitis B
    113260293
   05160 Hepatitis C
    113260293
   05168 Herpes simplex virus 1 infection
    113260293
   05163 Human cytomegalovirus infection
    113260293
   05167 Kaposi sarcoma-associated herpesvirus infection
    113260293
   05169 Epstein-Barr virus infection
    113260293
   05165 Human papillomavirus infection
    113260293
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113260293
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interferons
   113260293
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 113260293
NCBI-ProteinID: XP_026361783
UniProt: A0A3Q7WJP5
LinkDB
Position
Unknown
AA seq 228 aa
METDVFPFKRAHKARCSENLEPRFPDLPTPARPAASAGSPMALPFSFLVALVVLSGNSLC
SLGCDLPQNHGLFAWRALTLLGQMKRISLISCVHKYTHDFAFPKEVVDGKQLQKAQALSV
VHVMNQKIFHIFCTEASSAAWNTTLLEEFCSGLSEQLSVLEACPMQAARVGETPGMNVDS
ILRNYFQRISLYLQEKQYSPCAWETVRAEIMKPFSSSTTLQERLRGKK
NT seq 687 nt   +upstreamnt  +downstreamnt
atggaaactgatgtgttcccatttaagagggctcacaaggcaagatgctcagagaaccta
gagccacggttcccagacttgcccaccccagccaggccagcagcctctgcaggatcccca
atggccctgcccttctccttcttggtggccctggtggtgctcagcggcaactccctctgc
tctctgggctgtgacctgcctcagaaccatggcctgtttgcctggagggccttgacgctc
ctgggacaaatgaagagaatctcccttatctcttgtgtacacaagtacacacatgacttt
gccttccccaaggaggtggttgatggcaagcagttgcagaaggctcaagccctctcggtc
gtgcatgtgatgaaccagaagatcttccacatcttctgcacagaggcctcatctgctgct
tggaacacgaccctcctagaggaattctgctcgggactttctgagcagctgagcgtcctg
gaagcctgtcccatgcaggcggcgcgagtgggagagactcccggcatgaatgtggactcc
atcctgaggaactacttccaaagaatctccctctacctgcaagagaagcaatacagccct
tgtgcctgggagactgtcagagcagaaatcatgaaacccttctcttcatcaacaaccttg
caagaaaggttaaggggcaagaaatga

KEGG   Ursus arctos horribilis: 113260294
Entry
113260294         CDS       T05909                                 

Definition
(RefSeq) interferon alpha-2-like
  KO
K05414  interferon alpha
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04217  Necroptosis
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04623  Cytosolic DNA-sensing pathway
uah04630  Jak-STAT signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah05152  Tuberculosis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113260294
   04151 PI3K-Akt signaling pathway
    113260294
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113260294
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113260294
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113260294
   04621 NOD-like receptor signaling pathway
    113260294
   04622 RIG-I-like receptor signaling pathway
    113260294
   04623 Cytosolic DNA-sensing pathway
    113260294
   04650 Natural killer cell mediated cytotoxicity
    113260294
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113260294
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113260294
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113260294
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113260294
   05162 Measles
    113260294
   05164 Influenza A
    113260294
   05161 Hepatitis B
    113260294
   05160 Hepatitis C
    113260294
   05168 Herpes simplex virus 1 infection
    113260294
   05163 Human cytomegalovirus infection
    113260294
   05167 Kaposi sarcoma-associated herpesvirus infection
    113260294
   05169 Epstein-Barr virus infection
    113260294
   05165 Human papillomavirus infection
    113260294
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113260294
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interferons
   113260294
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 113260294
NCBI-ProteinID: XP_026361784
UniProt: A0A3Q7X5I4
LinkDB
Position
Unknown
AA seq 183 aa
MALSISVLLALVMLCSSPACSLDCTLRPSHPEPFVLLSQMERISILSCLKDRTDFSFPQM
LVDGSKFEKTEATAVMHEMFQQIFNLFSQSGSLVAWDETPLDKFLAGLHQQLEDLETCLE
EEKNVEQLLLGSENSRLAVKRYFHGIGLYLEKKKYSRCAWEVVRVEIRRCLFFVNELAGK
LRK
NT seq 552 nt   +upstreamnt  +downstreamnt
atggccctctcgatctctgtgctgctggccctggtgatgctgtgctccagccctgcctgc
tctttggactgcaccctgcgtccaagccatccagaacccttcgtgctgttgagtcaaatg
gagagaatctccattctatcctgtctgaaggataggactgacttcagctttcctcagatg
cttgtggatgggagcaagtttgagaagacagaagccacagctgtcatgcatgagatgttc
cagcagatcttcaacctcttcagccaaagtggctctcttgtggcttgggatgagacccca
ctagacaaattcctcgctggacttcatcagcagctggaagacctggagacatgtttggag
gaggaaaagaatgtggaacagttactcctgggaagcgagaactccagactggctgtgaag
agatacttccatggaatcggtctctatcttgaaaagaaaaaatacagccgctgtgcctgg
gaggttgtcagggtggaaatcagaaggtgcttgttcttcgttaacgagctcgcagggaaa
ctcaggaaataa

DBGET integrated database retrieval system