KEGG   Ursus arctos horribilis: 113260501
Entry
113260501         CDS       T05909                                 

Gene name
CCL27
Definition
(RefSeq) C-C motif chemokine 27
  KO
K16598  C-C motif chemokine 27
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113260501 (CCL27)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113260501 (CCL27)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    113260501 (CCL27)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113260501 (CCL27)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Chemokines
   113260501 (CCL27)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 113260501
NCBI-ProteinID: XP_026362116
UniProt: A0A3Q7VM65
LinkDB
Position
Unknown
AA seq 116 aa
MKGPSSTCSLLLLLLLLSPDPGAALPLPTSITCCTQLYRQPLSNKLLRRVIRVEVQEADG
DCHLQAFVLHLTRRSVCIHPQNRSLARWFERQGRMLQGTLPNLNLGLIGKMDQGPQ
NT seq 351 nt   +upstreamnt  +downstreamnt
atgaaggggccctcatccacatgcagcctcctgctgctactgttgctgctgagcccagac
cctggagcggcactgccactgccaaccagcattacctgctgtactcagctctaccgccag
ccactctcgaacaagctactgaggagggtcatccgggtggaagtgcaggaagctgatggg
gactgtcaccttcaggccttcgtgcttcacctgactcgacgcagtgtctgcatccaccct
cagaatcgcagcctggctcggtggtttgagcgccaagggaggatgctccaggggactctg
cctaacctgaatttggggctgatagggaaaatggaccagggccctcagtag

KEGG   Ursus arctos horribilis: 113260502
Entry
113260502         CDS       T05909                                 

Definition
(RefSeq) uncharacterized protein LOC113260502
  KO
K16598  C-C motif chemokine 27
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113260502
   04061 Viral protein interaction with cytokine and cytokine receptor
    113260502
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    113260502
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113260502
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Chemokines
   113260502
SSDB
Other DBs
NCBI-GeneID: 113260502
NCBI-ProteinID: XP_026362117
UniProt: A0A3Q7XHZ4
LinkDB
Position
Unknown
AA seq 87 aa
MSGLRRYEVALEAEEEIYWGCFYFFPWLRMWRRDRSSAHPREQKLEPLRGLMSCLSSGLG
PAPQRSGRGLPRRTPTATAQPAGALKI
NT seq 264 nt   +upstreamnt  +downstreamnt
atgtcgggattgaggagatacgaggtggcgctggaggcggaggaggagatctactggggt
tgcttctactttttcccctggctgcgcatgtggcggagggacaggagctcggcgcatccc
cgggagcagaagctggagcctctgcgaggcctgatgagctgtctgtcaagcggcctgggc
cctgccccccagcgctcgggtcgcggcctcccccgccgcacccccaccgccactgcccag
ccagccggtgcattaaagatttaa

KEGG   Ursus arctos horribilis: 113268975
Entry
113268975         CDS       T05909                                 

Definition
(RefSeq) C-C motif chemokine 8
  KO
K16596  C-C motif chemokine 8
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113268975
   04061 Viral protein interaction with cytokine and cytokine receptor
    113268975
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    113268975
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113268975
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Chemokines
   113268975
SSDB
Motif
Pfam: IL8 DUF3852
Other DBs
NCBI-GeneID: 113268975
NCBI-ProteinID: XP_026373401
UniProt: A0A3Q7WK88
LinkDB
Position
Unknown
AA seq 99 aa
MKVSAALLCLLLTAAAFSTQVLAQPGSVSIPITCCFSVVKKKIPMQKLESYTRVTNSQCP
QEAVVFQTKASKEICADPKLKWVQDYMKHLDQKSQTQKP
NT seq 300 nt   +upstreamnt  +downstreamnt
atgaaggtctctgcagcacttctgtgcctgctgctcacagccgccgccttcagcactcag
gtgctcgcccagccaggttcggtttccatcccaattacctgctgcttcagtgtggtcaaa
aagaagatccctatgcagaagctggagagctataccagggtcaccaacagccagtgtccc
caggaagctgtggtcttccagaccaaagcatccaaggagatctgtgctgaccccaagctg
aaatgggtccaggattacatgaagcacctggaccaaaagtcccaaacccagaagccttga

KEGG   Ursus arctos horribilis: 113268976
Entry
113268976         CDS       T05909                                 

Definition
(RefSeq) C-C motif chemokine 7-like
  KO
K05509  C-C motif chemokine 7
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04062  Chemokine signaling pathway
uah04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113268976
   04061 Viral protein interaction with cytokine and cytokine receptor
    113268976
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    113268976
   04062 Chemokine signaling pathway
    113268976
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113268976
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Chemokines
   113268976
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 113268976
NCBI-ProteinID: XP_026373402
UniProt: A0A3Q7Y6J4
LinkDB
Position
Unknown
AA seq 99 aa
MKVSATLLCLLLTAAAFSLQVLAQPDGISISATCCYRFTAKKIPEQKVKSYRRITSSYCP
REAVIFKTKLAKEVCADPKQKWVRNLMEYLDKKTQTPKL
NT seq 300 nt   +upstreamnt  +downstreamnt
atgaaggtctccgccacacttctctgcctgctgctcacagccgccgccttcagcctccag
gtgctcgcccagccagacgggattagcatctccgccacctgctgctatcgatttaccgct
aagaagatcccggagcagaaggtgaagagctacagaagaatcaccagcagctattgtccc
cgggaagccgtgatcttcaagaccaaactggccaaggaggtctgtgctgaccccaagcag
aagtgggtccggaatctcatggagtacctggacaagaaaacccaaaccccaaagctgtga

KEGG   Ursus arctos horribilis: 113268977
Entry
113268977         CDS       T05909                                 

Definition
(RefSeq) C-C motif chemokine 13-like
  KO
K16595  C-C motif chemokine 13
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04062  Chemokine signaling pathway
uah04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    113268977
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113268977
   04061 Viral protein interaction with cytokine and cytokine receptor
    113268977
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    113268977
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113268977
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113268977
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Chemokines
   113268977
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Chemokines
   113268977
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 113268977
NCBI-ProteinID: XP_026373404
UniProt: A0A3Q7Y0C8
LinkDB
Position
Unknown
AA seq 98 aa
MKVSATLLCLLLIAAALSIQVLAQPDALSAPFTCCFTFNNKKIPFRKLESYRITSSHCPR
EAVIFSTKLAKAICADPKEKWVQDYVKHLDQKSHSQRT
NT seq 297 nt   +upstreamnt  +downstreamnt
atgaaggtctcggcaacgcttctctgcctgctgctcatagctgccgccctcagcatccag
gtgctcgcccaaccagatgccctcagtgccccattcacttgctgtttcacatttaacaat
aagaagatcccctttcggaagctggagagctatcgaatcaccagcagccactgtccccgg
gaagctgtcatcttcagcacaaaactggccaaagctatctgcgccgacccaaaggagaag
tgggtccaggattatgtgaaacacctcgaccaaaaatctcatagccagaggacttga

KEGG   Ursus arctos horribilis: 113268978
Entry
113268978         CDS       T05909                                 

Definition
(RefSeq) C-C motif chemokine 2
  KO
K14624  C-C motif chemokine 2
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04062  Chemokine signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04657  IL-17 signaling pathway
uah04668  TNF signaling pathway
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah05135  Yersinia infection
uah05142  Chagas disease (American trypanosomiasis)
uah05144  Malaria
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05168  Herpes simplex virus 1 infection
uah05323  Rheumatoid arthritis
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    113268978
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113268978
   04061 Viral protein interaction with cytokine and cytokine receptor
    113268978
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    113268978
   04657 IL-17 signaling pathway
    113268978
   04062 Chemokine signaling pathway
    113268978
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    113268978
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113268978
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113268978
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    113268978
  09172 Infectious disease: viral
   05164 Influenza A
    113268978
   05168 Herpes simplex virus 1 infection
    113268978
   05163 Human cytomegalovirus infection
    113268978
  09174 Infectious disease: parasitic
   05144 Malaria
    113268978
   05142 Chagas disease (American trypanosomiasis)
    113268978
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113268978
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113268978
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Chemokines
   113268978
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Chemokines
   113268978
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 113268978
NCBI-ProteinID: XP_026373405
UniProt: A0A3Q7X7M3
LinkDB
Position
Unknown
AA seq 101 aa
MKVSATLLCLLLTAAAFSLQVLAQPDAISSPVTCCYTLTNKKISMQRLGSYKRVTSSKCP
KEAVIFKTILNKEICADPNQKWVRDSMAHLDKKTQTQTAKP
NT seq 306 nt   +upstreamnt  +downstreamnt
atgaaggtctccgccacacttctctgcctgctgctcacagccgccgccttcagcctccag
gtgctcgcccagccagatgcaattagttctccagtcacctgctgctatacactcaccaat
aagaagatctcgatgcagaggctggggagctataaaagagtcaccagcagcaagtgtccc
aaagaggctgtgatcttcaagaccatccttaacaaggagatctgtgctgaccccaaccag
aagtgggtccgggattccatggcacacctggataagaaaacccaaacccaaactgcaaag
ccatga

DBGET integrated database retrieval system