KEGG   Ursus arctos horribilis: 113260534
Entry
113260534         CDS       T05909                                 

Gene name
ICA1
Definition
(RefSeq) islet cell autoantigen 1 isoform X1
  KO
K19863  islet cell auto antigen 1
Organism
uah  Ursus arctos horribilis
Pathway
uah04940  Type I diabetes mellitus
Brite
KEGG Orthology (KO) [BR:uah00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113260534 (ICA1)
SSDB
Motif
Pfam: Arfaptin ICA69 Alpha-E
Other DBs
NCBI-GeneID: 113260534
NCBI-ProteinID: XP_026362189
UniProt: A0A3Q7WL14
LinkDB
Position
Unknown
AA seq 510 aa
MSGHKCSYPWDLQDRYTQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKL
ELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKAL
CFSSQQRLSLRNPLCRFHQEVETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDVSQEL
DPDLYKQMEKFRKVQTQVRLAKKSFDKLKMDVCQKVDLLGASRCNLLSHMLATYQTTLLH
FWEKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKKLIEKEERKKITQQESAEATAEEPS
QLISLEDENQHKESSSFKTEDGESVLSALDKSSTHNACSDELLDMKPEEGACLGPMAGTP
DPEGADKDDLLLLSEIFNASSLDEGEFSKEWAAVFGDDRLKEAAPTVAPAEPDPKPQTGS
GFLPSQLLDQNMKDLQASLQGWSESNVSPPPTPWPAPQASSPNDSSPAMKEPAKAASDLT
AWFSLFADLDPLSNPDAVGKTDKEHELLNA
NT seq 1533 nt   +upstreamnt  +downstreamnt
atgtcaggacacaaatgcagttatccctgggacttacaggatcgatatactcaagataag
tcagtagtaaataagatgcagcagaagtattgggaaacgaagcaggcctttattaaagcc
acagggaagaaggaagatgagcatgtcgttgcctccgatgcagacctggatgccaagctg
gagctgtttcactcaattcagagaacctgtttggacttgtctaaagcaatcgtactctat
caaaagagaatatgtttcttgtctcaagaagaaaacgaactgggaaaatttctccgatcc
caaggcttccaagataaaaccagagcaggaaagatgatgcaagcaacaggaaaggctctc
tgcttttcttcccagcaaaggttgtccttgagaaatcctttgtgtcgctttcaccaagaa
gtggagacttttcggcaccgggccatctcagacacttggctgacggtgaatcgcatggag
cagtgccggactgaatacagaggggcattattatggatgaaggatgtgtcacaggagctt
gatccagacctctacaagcaaatggagaagttcaggaaggtacaaacacaagtacgcctt
gccaaaaaaagctttgacaaattgaagatggatgtgtgtcagaaagtggatcttcttgga
gcaagccgatgcaatctgttgtctcatatgctagcaacgtaccagaccactctgcttcat
ttttgggagaaaacttctcacactatggcagccatccatgagagcttcaaaggttatcaa
ccatatgaattcactacattaaagagcttacaagaccctatgaaaaaactgattgagaaa
gaagaaaggaagaagatcacccagcaggaaagtgcagaggccaccgcggaggagccgagt
cagttaatttcattagaggacgaaaaccagcacaaggagtcttctagttttaagactgaa
gatggagaaagcgttttatctgccttagacaaaagctctacacataatgcatgctcagat
gaactattagacatgaaacctgaggaaggtgcttgcctgggcccaatggcagggacccca
gaccctgaaggtgctgacaaagatgacctgctgctgttgagtgagatcttcaacgcttcc
tcgctggacgagggtgagttcagcaaggagtgggctgctgtgtttggagacgaccggctg
aaggaggcagcacccactgtggccccagcagagccagaccccaagccccagacaggctca
ggattccttccttcacagcttttagaccaaaacatgaaagacttacaggcctcactacaa
ggctggtcagagagcaatgtcagtcctcctcctactccatggccagcaccacaggcaagc
agtccaaatgacagcagccctgcaatgaaagagcctgcgaaggctgcctcggacctgact
gcctggttcagcctctttgctgacctcgacccattatcaaatcctgatgctgttgggaaa
accgataaagaacacgaattgctcaatgcatga

DBGET integrated database retrieval system