KEGG   Ursus arctos horribilis: 113261197
Entry
113261197         CDS       T05909                                 

Gene name
IL17F
Definition
(RefSeq) interleukin-17F isoform X1
  KO
K05494  interleukin 17F
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04657  IL-17 signaling pathway
uah04659  Th17 cell differentiation
uah05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113261197 (IL17F)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    113261197 (IL17F)
   04657 IL-17 signaling pathway
    113261197 (IL17F)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113261197 (IL17F)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113261197 (IL17F)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113261197 (IL17F)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 113261197
NCBI-ProteinID: XP_026363043
UniProt: A0A3Q7WN98
LinkDB
Position
Unknown
AA seq 159 aa
MTTTILRNTAMVKSLLLVVLGLTLLREVAARKNPKTGDAALCPPLEDNSVRVDIRILRQN
QGIPISNDFQNRSSSPWDYNITRDPHRFPSEIAEAQCRYSGCINAEGQEDSSMNSVPIQQ
EFLVLRREPRGCSRSFRLEKVLVTVGCTCVTPIVRYVHA
NT seq 480 nt   +upstreamnt  +downstreamnt
atgacaacgaccatcctgcgcaacacggccatggtcaagtccctgctgctggtggtgctg
gggctcaccctcctgagggaggtggcagctcggaaaaacccaaaaacaggggatgctgcc
ctgtgccctcctctagaggataatagtgtgagggttgacatccgtatcctcaggcaaaac
cagggtattcccatctcaaatgatttccagaaccgctccagctccccctgggattacaac
atcacccgggacccccaccggttcccctcggagattgcggaggcccagtgcaggtactcg
ggctgcatcaatgctgaggggcaggaagacagctccatgaattcggtacccatccagcag
gagttcctggtcctgcggagggaacctcggggctgctctcgctccttccggctggagaaa
gtgctggtgacagtgggctgcacctgtgtcactcccattgtccgctatgtgcacgcctga

DBGET integrated database retrieval system