KEGG   Ursus arctos horribilis: 113261280
Entry
113261280         CDS       T05909                                 

Gene name
IL6
Definition
(RefSeq) interleukin-6
  KO
K05405  interleukin 6
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah01523  Antifolate resistance
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04066  HIF-1 signaling pathway
uah04068  FoxO signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04218  Cellular senescence
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04623  Cytosolic DNA-sensing pathway
uah04625  C-type lectin receptor signaling pathway
uah04630  Jak-STAT signaling pathway
uah04640  Hematopoietic cell lineage
uah04657  IL-17 signaling pathway
uah04659  Th17 cell differentiation
uah04668  TNF signaling pathway
uah04672  Intestinal immune network for IgA production
uah04931  Insulin resistance
uah04932  Non-alcoholic fatty liver disease (NAFLD)
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah05010  Alzheimer disease
uah05020  Prion diseases
uah05132  Salmonella infection
uah05133  Pertussis
uah05134  Legionellosis
uah05135  Yersinia infection
uah05142  Chagas disease (American trypanosomiasis)
uah05143  African trypanosomiasis
uah05144  Malaria
uah05146  Amoebiasis
uah05152  Tuberculosis
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05200  Pathways in cancer
uah05202  Transcriptional misregulation in cancer
uah05321  Inflammatory bowel disease (IBD)
uah05323  Rheumatoid arthritis
uah05332  Graft-versus-host disease
uah05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113261280 (IL6)
   04668 TNF signaling pathway
    113261280 (IL6)
   04066 HIF-1 signaling pathway
    113261280 (IL6)
   04068 FoxO signaling pathway
    113261280 (IL6)
   04151 PI3K-Akt signaling pathway
    113261280 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113261280 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113261280 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    113261280 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113261280 (IL6)
   04620 Toll-like receptor signaling pathway
    113261280 (IL6)
   04621 NOD-like receptor signaling pathway
    113261280 (IL6)
   04623 Cytosolic DNA-sensing pathway
    113261280 (IL6)
   04625 C-type lectin receptor signaling pathway
    113261280 (IL6)
   04659 Th17 cell differentiation
    113261280 (IL6)
   04657 IL-17 signaling pathway
    113261280 (IL6)
   04672 Intestinal immune network for IgA production
    113261280 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113261280 (IL6)
   05202 Transcriptional misregulation in cancer
    113261280 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    113261280 (IL6)
   05321 Inflammatory bowel disease (IBD)
    113261280 (IL6)
   05332 Graft-versus-host disease
    113261280 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113261280 (IL6)
   05020 Prion diseases
    113261280 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    113261280 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    113261280 (IL6)
   04931 Insulin resistance
    113261280 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    113261280 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113261280 (IL6)
   05135 Yersinia infection
    113261280 (IL6)
   05133 Pertussis
    113261280 (IL6)
   05134 Legionellosis
    113261280 (IL6)
   05152 Tuberculosis
    113261280 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113261280 (IL6)
   05162 Measles
    113261280 (IL6)
   05164 Influenza A
    113261280 (IL6)
   05161 Hepatitis B
    113261280 (IL6)
   05168 Herpes simplex virus 1 infection
    113261280 (IL6)
   05163 Human cytomegalovirus infection
    113261280 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113261280 (IL6)
   05169 Epstein-Barr virus infection
    113261280 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    113261280 (IL6)
   05144 Malaria
    113261280 (IL6)
   05142 Chagas disease (American trypanosomiasis)
    113261280 (IL6)
   05143 African trypanosomiasis
    113261280 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113261280 (IL6)
   01523 Antifolate resistance
    113261280 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113261280 (IL6)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113261280 (IL6)
SSDB
Motif
Pfam: IL6 GCSF IL11 IL23
Other DBs
NCBI-GeneID: 113261280
NCBI-ProteinID: XP_026363207
UniProt: A0A3Q7XKP5
LinkDB
Position
Unknown
AA seq 240 aa
MRLGMSEAHSALEPTRNERELHLPSRTPAMNSLSTSAFSPVAFSLGLLLVMATAFPTPGH
LGRDSKDEATSNRPPLISADKMEIIKYILGRISALKKEMCDKYNKCEDSKEALAENNLHL
PKLAEKDGCFQSGFNQDTCLTRIATGLLEFQVHLKYLQANYEGDKENANSVYFSTKVLLQ
MLMEKVKNQDEVTTPDPTTDTGLQAILKSQDKWLKQTTIHLILRNLEDFLQFSLRAVRVM
NT seq 723 nt   +upstreamnt  +downstreamnt
atgagactggggatgtctgaggctcattctgccctcgagcccaccaggaacgaaagagag
ctccatctgccctccaggaccccagctatgaactccctctccacaagcgccttcagtcca
gttgccttctccctggggctgctcctggtgatggctactgctttccctaccccgggacac
ctgggaagagattccaaagatgaggccacctcaaatagaccaccactcatctctgcagac
aaaatggaaatcattaaatacatcctcggcagaatctctgcactgaaaaaggagatgtgt
gacaagtataacaagtgtgaagacagcaaggaggcactggcagaaaacaacttacatctt
ccaaaactggcagaaaaggacggatgcttccaatctgggttcaatcaggacacctgcctg
acaagaatcgctaccggtcttctggagtttcaggtacacctgaaatacctccaggccaac
tatgaaggtgataaggaaaatgccaactctgtgtacttcagtaccaaagtcctgctccag
atgctgatggaaaaggtaaagaatcaggatgaagtgaccaccccagaccccaccacagac
accggcctgcaggctatcctgaagtcgcaggacaagtggctgaagcaaacaacaattcac
ctcatcctgcggaaccttgaggatttcctgcagttcagcctgagggcagtgcgggtcatg
tag

DBGET integrated database retrieval system