KEGG   Ursus arctos horribilis: 113261704
Entry
113261704         CDS       T05909                                 

Definition
(RefSeq) interleukin-3-like
  KO
K04736  interleukin 3
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04210  Apoptosis
uah04630  JAK-STAT signaling pathway
uah04640  Hematopoietic cell lineage
uah04664  Fc epsilon RI signaling pathway
uah05200  Pathways in cancer
uah05202  Transcriptional misregulation in cancer
uah05221  Acute myeloid leukemia
uah05310  Asthma
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    113261704
   04151 PI3K-Akt signaling pathway
    113261704
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113261704
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    113261704
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113261704
   04664 Fc epsilon RI signaling pathway
    113261704
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113261704
   05202 Transcriptional misregulation in cancer
    113261704
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    113261704
  09163 Immune disease
   05310 Asthma
    113261704
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113261704
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113261704
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113261704
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Cytokines
   113261704
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 113261704
NCBI-ProteinID: XP_026363707
UniProt: A0A3Q7XLV0
LinkDB
Position
Unknown
AA seq 142 aa
MHSLPILHVLLLLLGLRAPMAQGRSLSTYQPKQYFKMISEIMDILNNSPSPSEETLDPNE
TSTLLNTTLLRPNLDAFLNATKNFYNSESLIWKNLKEFLPLLPTPTPRGQPISIENNLGD
FQKKLKKYLEALDNFLNFKNKQ
NT seq 429 nt   +upstreamnt  +downstreamnt
atgcacagcctccccatcttgcacgttctcctgctcctgcttggactccgagccccaatg
gcacaggggcgctccttgtccacataccagcctaagcaatacttcaagatgatcagtgaa
attatggacatcttaaacaattcaccctcaccttcagaagaaaccttggacccaaatgag
acaagcaccctgctgaacactacccttctgaggccaaacctggatgcattcttgaatgct
accaaaaatttctacaacagtgaatcgctaatctggaaaaatcttaaggaattcctgcca
ctcctgcccactcccacacccagggggcaaccaatctctatcgagaataacttgggtgat
ttccaaaagaagctgaaaaagtatctggaagcccttgacaactttctgaatttcaagaac
aagcaatga

DBGET integrated database retrieval system