KEGG   Ursus arctos horribilis: 113261714
Entry
113261714         CDS       T05909                                 

Gene name
IL5
Definition
(RefSeq) interleukin-5
  KO
K05428  interleukin 5
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
uah04640  Hematopoietic cell lineage
uah04657  IL-17 signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04660  T cell receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04672  Intestinal immune network for IgA production
uah05200  Pathways in cancer
uah05310  Asthma
uah05320  Autoimmune thyroid disease
uah05321  Inflammatory bowel disease (IBD)
uah05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113261714 (IL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113261714 (IL5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113261714 (IL5)
   04660 T cell receptor signaling pathway
    113261714 (IL5)
   04658 Th1 and Th2 cell differentiation
    113261714 (IL5)
   04657 IL-17 signaling pathway
    113261714 (IL5)
   04664 Fc epsilon RI signaling pathway
    113261714 (IL5)
   04672 Intestinal immune network for IgA production
    113261714 (IL5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113261714 (IL5)
  09163 Immune disease
   05310 Asthma
    113261714 (IL5)
   05320 Autoimmune thyroid disease
    113261714 (IL5)
   05321 Inflammatory bowel disease (IBD)
    113261714 (IL5)
   05330 Allograft rejection
    113261714 (IL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113261714 (IL5)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113261714 (IL5)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113261714 (IL5)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Cytokines
   113261714 (IL5)
SSDB
Motif
Pfam: IL5
Other DBs
NCBI-GeneID: 113261714
NCBI-ProteinID: XP_026363733
UniProt: A0A3Q7WQ35
LinkDB
Position
Unknown
AA seq 134 aa
MRMLLHLSLLALGAAYVSVTAAESTMNGLVAETLTLLSAHRTLLIGDGNLMIPTPEHKNH
QLCIEEVFQGIDILKNRTAQGEAVDKLFRNLSLIKQHIEHQKKKCAGERWRVKKFLDYLQ
VFLGVINTEWTTES
NT seq 405 nt   +upstreamnt  +downstreamnt
atgagaatgcttctgcatttgagtttgctagctcttggggctgcctatgtttctgtcact
gctgcagaaagtaccatgaatggactggtggcagagaccttgacactgctctctgctcat
cgaactctgctgataggagatgggaacctgatgattcctactcctgaacataaaaatcac
caactgtgcattgaagaagtctttcagggcatagacatattgaagaaccgaactgcacaa
ggggaggctgtggataaactattccggaacttgtctttaataaaacaacacatagagcac
caaaaaaaaaagtgtgcaggagagagatggagagtaaaaaagttcctagactacctgcaa
gtgtttcttggtgtcataaacaccgagtggacaacagaaagttga

DBGET integrated database retrieval system