KEGG   Ursus arctos horribilis: 113261717
Entry
113261717         CDS       T05909                                 

Gene name
IL13
Definition
(RefSeq) interleukin-13
  KO
K05435  interleukin 13
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
uah04657  IL-17 signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04664  Fc epsilon RI signaling pathway
uah05200  Pathways in cancer
uah05310  Asthma
uah05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113261717 (IL13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113261717 (IL13)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    113261717 (IL13)
   04657 IL-17 signaling pathway
    113261717 (IL13)
   04664 Fc epsilon RI signaling pathway
    113261717 (IL13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113261717 (IL13)
  09163 Immune disease
   05310 Asthma
    113261717 (IL13)
   05321 Inflammatory bowel disease (IBD)
    113261717 (IL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113261717 (IL13)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113261717 (IL13)
SSDB
Motif
Pfam: IL13 GCIP
Other DBs
NCBI-GeneID: 113261717
NCBI-ProteinID: XP_026363736
UniProt: A0A3Q7VRJ9
LinkDB
Position
Unknown
AA seq 131 aa
MALWLTVVIALTCLGGLASPGPVPSHKALRELIEELVNITQNQASLCNGSMVWSVNQTAS
MYCAALESLLNVSDCSAIQRTQRMLKAMCLHTPSAGHLSSLRSQDTKIEVIQLVKNLLTH
VRRHFRHGNFT
NT seq 396 nt   +upstreamnt  +downstreamnt
atggcgctctggttgactgtggtcattgctctcacctgccttggtggccttgcctcccca
ggccctgtgccttcccacaaagccctcagggagctcattgaggaactggtcaacatcacc
cagaatcaggcgtccctctgcaatggcagcatggtgtggagcgtcaaccagaccgccagc
atgtactgcgcagctctagaatctttgctcaatgtctctgactgcagcgccatccaaagg
actcagaggatgctgaaagccatgtgccttcacactccctcggcagggcacctttccagt
ctgcgcagccaagacaccaaaattgaagtgatccagttggtgaaaaacctgctcacccat
gtacggagacattttcgccatggaaatttcacataa

DBGET integrated database retrieval system