KEGG   Ursus arctos horribilis: 113262493
Entry
113262493         CDS       T05909                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04020  Calcium signaling pathway
uah04072  Phospholipase D signaling pathway
uah04144  Endocytosis
uah04151  PI3K-Akt signaling pathway
uah04510  Focal adhesion
uah04540  Gap junction
uah04630  JAK-STAT signaling pathway
uah04810  Regulation of actin cytoskeleton
uah05163  Human cytomegalovirus infection
uah05200  Pathways in cancer
uah05206  MicroRNAs in cancer
uah05214  Glioma
uah05215  Prostate cancer
uah05218  Melanoma
uah05230  Central carbon metabolism in cancer
uah05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113262493 (PDGFRA)
   04014 Ras signaling pathway
    113262493 (PDGFRA)
   04015 Rap1 signaling pathway
    113262493 (PDGFRA)
   04630 JAK-STAT signaling pathway
    113262493 (PDGFRA)
   04020 Calcium signaling pathway
    113262493 (PDGFRA)
   04072 Phospholipase D signaling pathway
    113262493 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    113262493 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113262493 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113262493 (PDGFRA)
   04540 Gap junction
    113262493 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113262493 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113262493 (PDGFRA)
   05206 MicroRNAs in cancer
    113262493 (PDGFRA)
   05230 Central carbon metabolism in cancer
    113262493 (PDGFRA)
   05231 Choline metabolism in cancer
    113262493 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    113262493 (PDGFRA)
   05218 Melanoma
    113262493 (PDGFRA)
   05215 Prostate cancer
    113262493 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    113262493 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113262493 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113262493 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:uah04090]
    113262493 (PDGFRA)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     113262493 (PDGFRA)
Protein kinases [BR:uah01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   113262493 (PDGFRA)
CD molecules [BR:uah04090]
 Proteins
  113262493 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Herpes_gE V-set Kinase-like
Other DBs
NCBI-GeneID: 113262493
NCBI-ProteinID: XP_026364667
UniProt: A0A3Q7XP90
LinkDB
Position
Unknown
AA seq 1089 aa
MGTSLLAFLILGSLLTGPSRVFCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYP
MSEEENPNVEIRNEENNSGLFVAVLEVVSAAAAHTGLYTCYYNHTQTEETDIEGRRIYIY
VPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLRSNDGVVHASYDSRQGFNG
TFSVGPYICEATVRGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNN
EVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLRVPEATVKDSGDYECAARQATKEVK
EMKKVTISVHEKGFIEIKPNFSPLEAVDLHEVKHFVVDVQAYPPPRISWLKDNLTLIENL
TEITTDIEKIQEIRYRSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFELLTQVPSSILDL
VDDHHGSTGGQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWAILANNISNIITEVHPRD
RSTVEGRVTFTRVEETIAVRCLAKNLLGAESRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLNPADDSTRSY
VILSFENNGDYMDMKQADATQYVPMLERKEAAKYSDIQRSLYDRPASSKKKSVLDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWHSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDADNAYIGVTYKNEEDKLKDWEGSLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccttctggccttcctgatcttaggctctctcctcacagggcccagccga
gtcttctgccagctttcattaccctccatcctgccaaacgaaaatgaaaaggtcgtgcag
ctgaattcatccttttctctgagatgctttggggagagtgaagtgagctggcagtacccc
atgtctgaagaagagaaccccaatgtggaaatcagaaacgaggagaacaacagcggcctt
tttgtggccgtgctggaggtggtcagcgcggcggcggcgcacacgggcttgtacacctgc
tattacaaccacacccagacggaggagaccgacatcgagggcaggcgtatctacatctac
gtgccagacccggatgtagccttcgtgcctctgggaatgacagattatttagtcatcgtg
gaggatgatgattctgccatcataccttgtcgcacgactgatcccgagactccggtcacc
ttgcgcagcaatgacggggtggtgcacgcctcctatgacagcagacagggcttcaatggg
accttcagcgttgggccctatatctgtgaagccaccgtcaggggaaagaagttccagacc
atcccatttaatgtttatgctttaaaagcaacgtcagaacttgatctagaaatggaagct
cttaaaactgtgtataagtcaggggagacgattgtggtcacctgcgccgtctttaacaac
gaggtggtcgaccttcagtggacttaccctggagaagtgaaaggcaaaggcatcaccatg
ctggaggaaatcaaggtcccgtccatcaaattggtgtatactctgagggtccccgaggcc
acggtgaaagatagtggagattatgaatgtgctgcccgccaggccaccaaggaggtcaaa
gagatgaagaaagtcaccatttctgtccatgagaaagggttcattgaaatcaaacccaac
ttcagcccgttggaagctgtcgacctgcatgaagtcaaacatttcgtggtggacgtgcag
gcctacccccctcccaggatatcctggctgaaggacaacctgactctgattgaaaatctc
acggagatcaccacggacatagaaaagattcaggaaataaggtatcggagcaaattaaag
ctgatccgtgctaaggaggaagacagtggccattacacgatcgtcgttcaaaatgaagat
gacgtgaagagctatactttcgaactcctaactcaagttccctcatctattctggacttg
gtggacgaccaccacggctccacggggggacagaccgtgagatgcaccgccgaagggacg
cctcttcctgatatcgagtggatgatttgcaaggatattaagaagtgtaataatgaaact
tcatgggcgattttggccaacaatatctcaaacatcatcacggaggtccacccccgagac
aggagcactgtggagggccgagtgacgttcaccagagtggaggagaccatcgccgttcga
tgtctggccaagaatctccttggggccgagagccgcgagctcaagctggtggctcccacg
ctgcgctctgagctcacggtggctgctgccgtcctcgtgctgctggtgattgtcatcatc
tccctcatcgtcctggtcgtcatttggaaacagaaaccgaggtatgaaattcgctggagg
gtcattgaatccatcagcccggatggacatgaatatatttatgtggacccgatgcagctg
ccttatgactcgagatgggagtttccaagagatggactagtgcttggtcgtatcctggga
tctggcgcgtttgggaaagtggttgaaggaactgcctatggattaagccgctcccagcct
gtcatgaaggtagcagtgaagatgctgaaacccacagccagatccagtgagaaacaggct
cttatgtcggaactgaagataatgactcacctggggccgcatttaaacattgtgaacttg
ctgggagcctgtaccaagtcaggccctatttacatcatcactgagtactgcttctatggg
gatttggtcaactatttgcataagaatagggatagcttcctgagccgccacccggagaag
ccaaagaaagagctggacatttttggattgaaccctgccgacgacagcacacggagttac
gtcattttatcttttgaaaacaacggtgactacatggacatgaagcaagctgacgccacc
cagtacgtccccatgctggaaaggaaagaggctgccaagtactcagacatccagagatcg
ctgtatgatcgcccggcctcgtctaagaagaagtctgtgttagactcagaagtcaaaaac
ctcctttcggatgataactcagaaggccttactttgttggatttgttgagctttacctat
caagttgcacgaggaatggaatttttggcttcgaaaaattgtgtccaccgggacctggct
gctcgaaacgtcctcctggcgcaagggaaaatcgtgaagatctgtgacttcggcctggcc
agagacatcatgcacgattcgaactacgtgtcgaaaggcagtacctttctccctgtgaag
tggatggcccctgagagcatcttcgacaacctctacaccacactgagtgacgtctggtct
tacggcattctgctctgggagatcttttccctcggcggcacaccctaccccggcatgatg
gtggattctactttctacaataagattaagagtgggtaccggatggccaagcctgaccac
gccaccagtgaagtctacgagatcatggtgaaatgctggcacagtgagccggagaagaga
ccctccttctaccacctgagtgagattgtggagaacctgctgcccggacagtataagaag
agttacgaaaagattcacctggacttcctgaagagcgaccaccccgccgtggcgcgcatg
cgcgtggacgccgacaacgcctacattggcgtcacctacaaaaacgaggaagacaagctg
aaggactgggagggcagcctggacgagcagaggctgagcgcggacagcggctacatcatc
cccctgcccgacatcgaccctgtccctgaggaggaagacctgggcaagaggaacagacac
agctcgcagacctcagaagagagtgctatcgagacaggttcgagcagctccaccttcatc
aagagagaggacgagaccatcgaggacatcgacatgatggacgacattggcatagactcc
tcagacctggtagaggacagcttcctgtga

DBGET integrated database retrieval system