KEGG   Ursus arctos horribilis: 113262503
Entry
113262503         CDS       T05909                                 

Gene name
KDR
Definition
(RefSeq) vascular endothelial growth factor receptor 2 isoform X1
  KO
K05098  kinase insert domain protein receptor [EC:2.7.10.1]
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04370  VEGF signaling pathway
uah04510  Focal adhesion
uah05205  Proteoglycans in cancer
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113262503 (KDR)
   04015 Rap1 signaling pathway
    113262503 (KDR)
   04010 MAPK signaling pathway
    113262503 (KDR)
   04370 VEGF signaling pathway
    113262503 (KDR)
   04151 PI3K-Akt signaling pathway
    113262503 (KDR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113262503 (KDR)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    113262503 (KDR)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113262503 (KDR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113262503 (KDR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113262503 (KDR)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:uah04090]
    113262503 (KDR)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     113262503 (KDR)
Protein kinases [BR:uah01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   113262503 (KDR)
CD molecules [BR:uah04090]
 Proteins
  113262503 (KDR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_3 I-set Pkinase Ig_2 ig VEGFR-2_TMD V-set C2-set_2 Ig_5 Ig_4
Other DBs
NCBI-GeneID: 113262503
NCBI-ProteinID: XP_026364697
UniProt: A0A3Q7XPB8
LinkDB
Position
Unknown
AA seq 1355 aa
MESKALLAIALWLCVETRAASVGLPSVSLDPPRLSIQKDILTITANTTLQITCRGQRDLD
WLWPNNQSGSEKRVEVAECSDSLFCKTLTIPKVIGNDTGAYKCFYRDADTASVIYVYVQD
YRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGHRISWD
SKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYKIYDVVLSPHHRVELSVGE
RLVLNCTARTELNVGIDFNWEYPSLKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRS
DQGWYTCAASSGLMTKRNSTFVRVHEKPFVAFDSGMESLVEVTVGNRVEVPVKYLAYPTP
EIKWYKNGRPIESNHTIKGEKELIIMEVSEKDTGNYTVILTNPISKEKQSHVVSLLVNVP
PQIGEKSLISLVDSYQYGTTQTLTCTVYSVPPPHHIRWYWQLEECAYKPTQAVLMTNPYT
CKEWRDVDDFQGGNKIEVNKNQFALIEGKNKTVSTLVIQAANVSALYKCEAINKVGRGER
VISFHVTRGPEITLQPDTQPTERENVSLWCTADRTMFENLTWYKLGPHALPVHAGELPTP
VCKNLDALWKMNATKFSNGTSDILIMELQNASLRDQGDYVCFAQDRKTKKRHCVVRQLKV
LERVAPMITGNLENQTTSIGETIEVSCTTSGNPPPQVTWFKDNETLVEDSGIVLKDGNRN
LTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIVEGAQEKTNLEVIILVGTAVIAMFFWLL
LVIVLRTVKRANGGELKTGYLSIVMDPDELPLDEHCERLPYDASKWEFPRDRLKLGKPLG
RGAFGQVIEADAFGIDKTATCKTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNL
LGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKSKGARFRQGKEYVGEITMDPKR
RLDSITSSQSSASSGFVEEKSLSDVEEEEVSEDLYKNFLTLEHLICYSFQVAKGMEFLAS
RKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDRV
YTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLD
CWHGEPNQRPTFSELVEHLGNLLQANAQQDGKDYIVLPIAETLSMEEDSGLSLPTSPVSC
MEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDSG
MVLASEELKTLEDRTKLAPSFSGLMPSKSKESVASEGSNHTSGYQSGYHSDDTDTTVYSS
EEAELLKLMEIGPQAGSAAQILPPDSGPTLSSPPV
NT seq 4068 nt   +upstreamnt  +downstreamnt
atggagagcaaggcgctgctggccatcgctctgtggctctgcgtggagaccagggctgcc
tccgtgggtttgcctagtgtttcccttgatccacccagactcagcatacaaaaagacata
cttacaattacggctaatacaactcttcagattacttgcaggggacagagggacttggac
tggctctggcccaacaatcagagtggctctgagaaaagagtggaggtggccgagtgcagt
gatagcctcttctgtaagactcttacgattccaaaagtgattggaaatgatactggagcc
tacaagtgcttctatcgggacgctgacacggcctcggtcatttatgtctacgttcaagat
tacagatctccatttattgcttctgttagcgaccagcatggagttgtgtacatcactgag
aacaaaaacaaaactgtggtgattccatgtcttgggtccatttccaacctcaatgtgtca
ctttgtgcaaggtatccagaaaagaggtttgttcctgatggtcacagaatttcctgggac
agtaagaaaggctttactattcccagctacatgatcagctatgctggcatggtcttctgt
gaagcaaaaattaatgatgaaagttaccagtctattatgtacatagtggtggttgtaggg
tacaagatttatgatgtggtactcagcccccatcacagagttgagctgtctgttggagag
aggcttgtcttaaattgtacagcgaggactgaactaaatgtggggattgacttcaactgg
gaatacccttctttgaagcatcagcataaaaaacttgttaaccgggacctaaaaacccag
tctgggagtgagatgaagaaatttttgagcaccttgactatagatggtgtaacccggagt
gaccaaggctggtacacctgtgcagcttccagtgggctgatgaccaagcggaacagcaca
ttcgtcagggtccatgaaaaaccttttgttgcttttgatagtggcatggaatctttggtg
gaagtcacagtggggaaccgtgttgaagtccctgtgaagtacctggcttaccctaccccc
gaaataaaatggtataaaaatggaagacccattgaatccaatcacacaataaaaggggag
aaggaactaattattatggaagtgagtgaaaaagataccggaaattatactgtcatcctc
accaaccccatttcaaaagagaaacagagccacgtggtatctctgcttgtgaatgtccca
ccccagatcggtgagaaatccctgatctctctggtggattcctaccagtacggcaccaca
caaaccctgacatgcacggtctactccgtccccccgccgcatcacattcgctggtattgg
cagctggaggagtgcgcctacaagcccacccaagctgtcttgatgacaaacccatatact
tgtaaggaatggagggatgtggatgacttccaggggggcaataaaattgaagtcaacaaa
aatcaatttgccctaattgaaggaaaaaacaaaactgtaagtacccttgttatccaagcg
gcaaatgtgtcagctttgtacaaatgtgaagccatcaacaaagttgggagaggagagagg
gtgatctccttccacgtgactcggggccctgaaatcactttgcaacctgacacccagccc
accgagcgggagaacgtgtccttgtggtgtactgcagacagaactatgtttgagaacctc
acgtggtacaagcttggcccacatgctctgccagtccatgcgggagagttgcccacacct
gtttgcaagaacttggatgctctttggaaaatgaacgccaccaagttttctaatggcaca
agtgacattttgatcatggagctccagaacgcatccttgcgggaccaaggagactatgtg
tgctttgctcaggacaggaagaccaagaaaagacattgtgtggtcagacagctcaaagtg
ttagagcgtgtggcgcccatgatcactggaaacctggagaatcagactacaagcattggg
gaaaccattgaagtctcatgcaccacatctgggaatccccctccacaagttacgtggttt
aaagacaatgagacacttgtagaagactcaggaattgtactgaaagatgggaaccggaac
ctaaccatccgcagggtgaggaaggaggatgaaggcctctacacctgccaggcatgcagt
gtccttgggtgtgcaaaagtggaggcatttttcatagtagaaggtgcccaggagaagaca
aacttggaagtcattattctagtaggcacggcagtgattgccatgttcttctggttatta
cttgtcatcgttctacggaccgttaagcgggccaatggaggggaactgaagacaggctac
ttgtccatcgtcatggatccagatgagctccccttggatgagcactgtgagcgcctgcct
tacgatgccagcaaatgggagttccccagagaccggctgaaactaggtaagcctcttggc
cgtggtgcctttggccaagtgattgaagcagatgcctttggaatcgacaagacagcaact
tgcaagacagtggccgtcaaaatgttaaaagaaggagcaacacacagtgaacaccgagct
ctcatgtctgaactcaagatcctcattcatattggccaccatctcaatgtggtcaatctt
ctaggtgcctgtaccaagccaggagggccactcatggtgattgtggaattttgcaagttt
ggaaacttgtcgacttacttaaggagcaagagaaacgaatttgtcccctacaagagcaaa
ggggcacgattccgtcaagggaaagagtacgttggggagatcactatggatccgaaacgc
cgcttggacagtatcaccagtagtcagagctcagccagctctggatttgttgaggagaaa
tccctcagtgacgtggaggaagaggaagtttccgaagatctgtacaagaacttcctgacc
ttggagcacctcatctgctacagcttccaagtggctaagggcatggagtttttggcatcc
cggaagtgtatccacagggacctggcggcacgcaacatcctcctgtcggagaagaacgtg
gttaaaatctgtgactttggcttggcccgggatatttataaagacccagattatgtcaga
aaaggagatgctcgcctccctttgaaatggatggccccagaaacaatttttgacagagtg
tacacaattcagagtgatgtgtggtcttttggtgtcttgctctgggaaatattttcctta
ggtgcttctccgtatcctggagtaaagattgatgaggaattttgtaggcgattgaaagaa
ggcactagaatgagggcccctgattataccacaccagaaatgtaccagaccatgcttgac
tgctggcacggggagcccaatcagagacccacgttttcagagctggtggaacacttggga
aatctgttacaagctaatgctcagcaggatggcaaagactacattgttctcccgatagca
gagactttgagcatggaagaggattctggactctctctgcctacctcacctgtttcctgt
atggaggaagaggaagtgtgtgaccccaaattccattatgacaacacagcaggaatcagc
cagtatctgcagaacagtaagcgaaagagccggcctgtgagtgtaaaaacatttgaagat
atcccgttggaagaaccagaagtaaaagtaatcccagatgacaaccagacggacagtggt
atggtcctggcatcagaagagctgaaaaccttggaagacagaaccaaattagctccatct
tttagtggactgatgcccagcaaaagcaaggagtctgtggcatccgaaggctctaaccac
acgagtggctaccagtctgggtatcactctgatgacacggacaccactgtgtactccagc
gaggaggccgaactgttaaagctgatggagattggaccacaagctggcagcgcagcccag
attctcccgcctgactctgggcccacattgagctctcctcctgtttaa

DBGET integrated database retrieval system