KEGG   Ursus arctos horribilis: 113262740Help
Entry
113262740         CDS       T05909                                 

Gene name
COLGALT2
Definition
(RefSeq) procollagen galactosyltransferase 2 isoform X1
  KO
K11703  collagen beta-1,O-galactosyltransferase [EC:2.4.1.50]
Organism
uah  Ursus arctos horribilis
Pathway
uah00310  Lysine degradation
uah00514  Other types of O-glycan biosynthesis
uah01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:uah00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    113262740 (COLGALT2)
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    113262740 (COLGALT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:uah01003]
    113262740 (COLGALT2)
Enzymes [BR:uah01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     113262740 (COLGALT2)
Glycosyltransferases [BR:uah01003]
 O-Glycan biosynthesis
  O-linked Gal type
   113262740 (COLGALT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_25 Glyco_tranf_2_4 Anp1 Glyco_transf_92 Aminotran_4
Motif
Other DBs
NCBI-GeneID: 113262740
NCBI-ProteinID: XP_026364995
UniProt: A0A3Q7WIW3
LinkDB All DBs
Position
Unknown
AA seq 626 aa AA seqDB search
MAARRAATLACSLLLLSAALLRRGCRARFAAEPDSEHDAEETQVFPESPVQRPTVLVAIL
ARNAAHALPHFLGCLERLDYPKSRMAIWAATDHNVDNTTEILREWLKNVQRFYHYVEWRP
MDEPESYPDEIGPKHWPGSRFAHVMKLRQAALRTAREKWSDYILFIDVDNFLTNPQTLNL
MIAENKTIVAPMLESRGLYSNFWCGITPQGFYKRTPDYLQIREWKRLGCFPVPMVHSTFL
IDLRKEASDKLMFYPPHQDYTWTFDDIIVFAFSSRQAGIQMYLCNREHYGYLPIPLKPQQ
TLQEEIENLVHVQIEAMIDGPPMEPSQFVSVVPKYPDKMGFDEIFMINLKRRKDRRDRML
RTLYEQEIEVKIVEAVDGKALNTSQLKALNIEMLPGYRDPYSSRPLTRGEIGCFLSHYSV
WKEVIDRELEKTLVIEDDVRFEHQFKKKLMKLMDDIDQAQLDWELIYIGRKRMQVKEPEK
AVPNVGNLVEADYSYWTLGYVISLEGAQKLVGADPFGKMLPVDEFLPIMYNKHPVAEYKE
YYESRDLKAFSVEPLLIYPTHYTGQPGYLSDTETSTIWDNETVATDWDRTHSWKSRKQSH
IHRNAKNTEALPSPTSLDAVPSRDEL
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgcgccgcgccgccaccctcgcctgctcgctgctgctcctgtccgccgctctg
ctccgccgcggctgccgggcgcgctttgccgcggagcccgactcggagcacgacgcagag
gagacgcaggtttttcccgagtcgccggtgcagagacccacggtgctagtggccatcctc
gcccgcaacgctgcgcacgcgctgccgcacttcctcggctgcctggagcggctggactac
cccaagagcaggatggccatctgggcagccactgaccacaatgtggataatacaacagaa
atactcagggagtggttgaaaaatgtacagagattctatcactatgtggagtggaggcct
atggatgaaccagaatcttaccctgatgaaattggaccaaagcattggccaggctcccgg
tttgcccatgtgatgaaactacggcaggcggcccttcgaactgcgagggaaaaatggtca
gactacattctgttcatagatgttgacaacttcctgactaatccacagaccctcaatcta
atgattgcagaaaacaaaaccattgtggcacccatgctggagtctcggggcctgtactct
aatttctggtgcggaatcacacctcagggcttctataaacgcaccccagactaccttcag
atcagagaatggaagaggttgggctgctttcccgtccctatggttcactccacattccta
attgacctcaggaaggaagcctccgacaagctgatgttctatcccccgcaccaggactat
acctggacctttgatgacatcatcgtctttgccttctccagcaggcaagcaggcatccag
atgtacctctgcaaccgagagcattatggctacctgcccatccccctgaagccccagcag
accctgcaggaggaaatcgagaacctcgtccacgtgcagatagaagcgatgattgacggt
cctccaatggaaccctcccagtttgtttcagttgtccctaaatatccagacaagatggga
tttgatgagattttcatgatcaacctgaagcgccgaaaggacaggcgggaccggatgtta
cgcaccctgtacgagcaagagatcgaggtcaagattgtcgaggctgtggatggaaaggca
ctcaacacaagccagctaaaggccctgaatattgaaatgctgccaggataccgagatccc
tactcttctaggcctctcaccaggggtgaaatcggctgctttctcagccactactctgtc
tggaaagaggtgattgaccgagagctggagaagactctggttattgaggacgatgtgcgc
ttcgaacatcagtttaagaagaagctgatgaagctgatggatgacatcgaccaggctcag
ctggattgggaactgatttatatcggcaggaagaggatgcaggtgaaagagcctgagaaa
gcagtgcccaacgtgggaaatctggtcgaagccgactactcctattggacgctgggctac
gtcatctctctggaaggagcacagaagctggttggagccgatccctttgggaagatgctg
ccagtggacgagttcctgccaatcatgtacaacaagcatcccgtagctgagtacaaggag
tattatgaatccagggacctgaaggccttctccgtggaacccttgctcatctaccccaca
cactacacgggccagccggggtatctgagtgacacagagacctcgaccatctgggacaat
gagacagtggccaccgactgggacaggacccattcctggaagtcccggaagcaaagtcac
atccaccgcaatgccaagaacacagaggccttgccgtcgccaacctccctggacgctgtg
ccttcgagggatgagctatga

DBGET integrated database retrieval system