KEGG   Ursus arctos horribilis: 113262825Help
Entry
113262825         CDS       T05909                                 

Gene name
FASLG
Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
uah  Ursus arctos horribilis
Pathway
uah01524  Platinum drug resistance
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04060  Cytokine-cytokine receptor interaction
uah04068  FoxO signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04210  Apoptosis
uah04217  Necroptosis
uah04650  Natural killer cell mediated cytotoxicity
uah04722  Neurotrophin signaling pathway
uah04932  Non-alcoholic fatty liver disease (NAFLD)
uah04940  Type I diabetes mellitus
uah05142  Chagas disease (American trypanosomiasis)
uah05143  African trypanosomiasis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05168  Herpes simplex virus 1 infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05205  Proteoglycans in cancer
uah05320  Autoimmune thyroid disease
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113262825 (FASLG)
   04010 MAPK signaling pathway
    113262825 (FASLG)
   04068 FoxO signaling pathway
    113262825 (FASLG)
   04151 PI3K-Akt signaling pathway
    113262825 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113262825 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    113262825 (FASLG)
   04217 Necroptosis
    113262825 (FASLG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    113262825 (FASLG)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    113262825 (FASLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113262825 (FASLG)
   05205 Proteoglycans in cancer
    113262825 (FASLG)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113262825 (FASLG)
   05330 Allograft rejection
    113262825 (FASLG)
   05332 Graft-versus-host disease
    113262825 (FASLG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113262825 (FASLG)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    113262825 (FASLG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113262825 (FASLG)
   05162 Measles
    113262825 (FASLG)
   05164 Influenza A
    113262825 (FASLG)
   05161 Hepatitis B
    113262825 (FASLG)
   05160 Hepatitis C
    113262825 (FASLG)
   05168 Herpes simplex virus 1 infection
    113262825 (FASLG)
   05163 Human cytomegalovirus infection
    113262825 (FASLG)
   05165 Human papillomavirus infection
    113262825 (FASLG)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    113262825 (FASLG)
   05143 African trypanosomiasis
    113262825 (FASLG)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    113262825 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113262825 (FASLG)
   04052 Cytokines and growth factors [BR:uah04052]
    113262825 (FASLG)
   04090 CD molecules [BR:uah04090]
    113262825 (FASLG)
Exosome [BR:uah04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   113262825 (FASLG)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Tumor necrosis fators
   113262825 (FASLG)
CD molecules [BR:uah04090]
 Proteins
  113262825 (FASLG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 113262825
NCBI-ProteinID: XP_026365130
UniProt: A0A3Q7WJ82
LinkDB All DBs
Position
Unknown
AA seq 278 aa AA seqDB search
MQQPLNYPYPQIYWVDSSAGSPWAPPGSVLPCPSSVPGRPPPPRRPPPPPPPTLPPPPPL
APLPLPPVKTRRDHNTGACLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQSHI
ASSLEKQIGQPNPPSEKRELRKVAHLTGKSNSRSIPLEWEDTYGIALVSGVKYKKGGLVI
NDTGLYFVYSKVYFRGQSCNNQPLNHKVYMRNSKYPQDLVLMEGKIMNYCTTGQMWARSS
YLGAVFNLTSADHLYVNVSELSLVSFEESKTFFGLYKL
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagcccttgaactacccgtacccccaaatctactgggtggacagcagtgccggc
tctccctgggcccctcccggctcagtcctcccgtgtccatcctctgtgccgggaaggcca
ccgccacccaggaggccaccgccaccaccgccaccaacactaccgccgccaccaccgctg
gctccgctgccgctgccgcctgtgaagacgcggagggaccacaacacaggcgcgtgcctc
cttgtgatgtttttcatggttctggtggccctggttggactggggctgggcatgttccag
ctctttcacctacagaaggagctggccgaactcagagagtccaccagccaaagtcatata
gcatcatctttggagaagcaaataggtcaacccaacccaccctctgaaaaaagggagctg
agaaaagtggcccatttaacaggcaagtccaactcaagatccatccctctggaatgggaa
gacacgtatggaattgcccttgtctctggggtgaagtataagaagggtggccttgtgatc
aatgatactgggttgtactttgtgtattccaaagtgtacttcaggggtcagtcctgcaac
aaccagcccctgaaccacaaggtctatatgaggaactctaagtatccccaggacctggtg
ctgatggaggggaagataatgaactactgcactactggccagatgtgggcccgcagcagc
tacctgggagcggtattcaatctcaccagtgctgaccatttatatgtcaatgtatctgaa
ctgtctctggtcagttttgaggaatctaagacattttttggcttatataagctctaa

DBGET integrated database retrieval system