KEGG   Ursus arctos horribilis: 113262984
Entry
113262984         CDS       T05909                                 

Definition
(RefSeq) formin-like protein 5
  KO
K23612  neural Wiskott-Aldrich syndrome protein
Organism
uah  Ursus arctos horribilis
Pathway
uah04144  Endocytosis
uah04520  Adherens junction
uah04810  Regulation of actin cytoskeleton
uah05100  Bacterial invasion of epithelial cells
uah05132  Salmonella infection
uah05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113262984
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    113262984
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113262984
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113262984
   05135 Yersinia infection
    113262984
   05100 Bacterial invasion of epithelial cells
    113262984
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113262984
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:uah04812]
    113262984
Membrane trafficking [BR:uah04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    113262984
Cytoskeleton proteins [BR:uah04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     113262984
SSDB
Other DBs
NCBI-GeneID: 113262984
NCBI-ProteinID: XP_026365374
UniProt: A0A3Q7XG12
LinkDB
Position
Unknown
AA seq 313 aa
MPEKYKGRSTELRRSHGDEAATPPPPARPPPALPAPPAAPLRRPPPRRPPLHLSAPPVTL
ATAAAARGRGLRARPGPASALPARGARSSAPAPTRPRSGGAQPQAPREPTQEASPPHGRP
GPERREQGRKHRGGGGGCWRALGGRTVSPEPPPAPPDLPAPRKPPQTSLPVLLGRKESLE
EVPRPARLDEKGSRKKSPLWPEGRCWGNRKVRAEGALGWRDGPERDSPSGAGVMLSRQPP
PQVHRNKQNNKLHTAPWWDDSPPLPEDFDRAGPSAHFVCWCDVQALTPNVTISAEPVLGE
VIQGYMSSSGLWS
NT seq 942 nt   +upstreamnt  +downstreamnt
atgccagagaaatacaaagggcgctcaaccgagctgcgccgttcccatggcgacgaggca
gcgactccgcccccgcccgctcgcccgcccccggccctccccgccccgcccgctgcgccg
ctccgccggcccccgccgcggcggcctcccctccacctgagcgcccccccggtaaccctg
gcaacggcggccgcggcgcgcgggaggggactccgagcgcggccaggccccgcctccgcc
ctccccgcccgcggcgcccggagctcggcccctgccccgacccgccctcgctcgggcggg
gctcagccgcaggcgccgcgggagccgacgcaggaagcttctcctccccacggccggccc
ggcccggaaaggcgggagcaggggaggaagcaccgcggcggcggcggaggctgctggaga
gccctgggcggtcgcacagtctccccggagcctcctccggccccacctgacctcccggcc
cctcgaaaacctccccagacctccctgcccgtcctcctgggaaggaaggagagcttggag
gaggttcctcggcccgctcggctagatgaaaaagggagccggaaaaaaagccctctttgg
cccgagggccggtgttggggaaacaggaaagtgcgggccgagggggcactgggctggagg
gacgggccggagcgcgactcgccgtcgggagccggggtcatgctttccagacagcctcct
ccccaagtgcaccgcaacaaacaaaacaataaactgcacactgctccgtggtgggatgac
agcccacccctccccgaggatttcgaccgtgcaggaccctcggcgcatttcgtttgttgg
tgtgacgttcaagccctaactcccaatgtgactatatctgcagagccggtcttaggagag
gtaattcaaggttacatgagttcatcaggactgtggtcctag

KEGG   Ursus arctos horribilis: 113263592
Entry
113263592         CDS       T05909                                 

Gene name
WASL
Definition
(RefSeq) neural Wiskott-Aldrich syndrome protein
  KO
K23612  neural Wiskott-Aldrich syndrome protein
Organism
uah  Ursus arctos horribilis
Pathway
uah04144  Endocytosis
uah04520  Adherens junction
uah04810  Regulation of actin cytoskeleton
uah05100  Bacterial invasion of epithelial cells
uah05132  Salmonella infection
uah05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113263592 (WASL)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    113263592 (WASL)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113263592 (WASL)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113263592 (WASL)
   05135 Yersinia infection
    113263592 (WASL)
   05100 Bacterial invasion of epithelial cells
    113263592 (WASL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113263592 (WASL)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:uah04812]
    113263592 (WASL)
Membrane trafficking [BR:uah04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    113263592 (WASL)
Cytoskeleton proteins [BR:uah04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     113263592 (WASL)
SSDB
Motif
Pfam: WH1 PBD WH2 DUF4918 PQQ
Other DBs
NCBI-GeneID: 113263592
NCBI-ProteinID: XP_026366090
UniProt: A0A3Q7WLT4
LinkDB
Position
Unknown
AA seq 505 aa
MSSGQQQPPPPRRVTNVGSLLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKK
CSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALN
FANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQVN
NISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCG
ISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHSSGPP
PPPARGRGAPPPPPSRAPTAAPPPPPPSRPGVGVPPPPPNRMYPPPPPALPSSAPAGPPP
PPPPLSLAGSAAPPPPPPPPPPPGPPPPPGLPSDGDHQVPTPAGNKAALLDQIREGAQLK
KVEQNSRPVSCSGRDALLDQIRQGIQLKSVSDGQESTPPTPAPTSGIVGALMEVMQKRSK
AIHSSDEDEDEDDEEDFEDDDEWED
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgagctccggccagcagcagccgccgccaccgcggagggtcaccaatgtggggtctttg
ctgctcaccccgcaggagaatgagtctctcttcaccttcctcggcaagaaatgtgtgact
atgtcttcagcagtggtacagttatatgcagcagatcgtaactgtatgtggtcaaagaag
tgcagcggtgtcgcttgtcttgttaaggacaatccacagagatcttattttttaagaata
tttgatattaaggatgggaaactattgtgggaacaagagctatacaataactttgtatat
aatagtcctagaggatattttcatacctttgctggagatacttgtcaagttgctcttaat
tttgccaatgaagaagaagcaaaaaaattccgaaaagcagttacagacttgttgggccgg
cgacaaaggaaatctgagaaaagacgagaccccccaaatggtcctaatctacccatggca
acagttgacataaaaaatccagaaatcactaccaatagattttatggtccacaagtcaac
aacatttcccataccaaagaaaagaaaaaaggaaaagctaaaaagaagagattaaccaag
gcagatattggaacaccaagcaacttccagcacattggacatgttggttgggatccgaat
actggctttgatctgaataatttggatccagaattgaagaatctttttgatatgtgtgga
atctcagaggcacaacttaaagaccgagaaacatcaaaagttatatatgacttcattgaa
aaaacaggaggtgtagaagctgttaaaaatgaactgcgaaggcaagcaccacctcctcca
ccaccatctaggggagggccgccgcctcctccccctcctccacatagctcaggccctccg
ccccctcctgccaggggcagaggcgctcctcctccaccaccttcaagagctcccactgct
gcacctccaccgccgcctccgtccaggccaggtgtaggagtccctccaccgccaccaaat
aggatgtaccctcctccacctccagcgcttccctcctcagcaccggcagggcctccacca
ccacctccacctctgtcgttggcggggtcagcggcaccacccccgccacctccacctccg
cctccaccggggcctccgcctccccctggcctcccttctgatggtgaccatcaagttcca
actcctgcaggaaacaaagcagctcttttagatcaaattagagagggtgctcagctaaaa
aaagtggaacagaacagtagaccggtatcctgctctggaagggatgcacttttagaccag
atacgacagggtattcagctgaaatctgtatctgatggccaagagtctacaccaccaaca
cctgcacccacttcaggaattgtgggtgcattaatggaagtgatgcagaaaaggagcaaa
gccattcattcttcagatgaagatgaggatgaagatgatgaagaagattttgaggatgat
gatgaatgggaagactga

DBGET integrated database retrieval system