KEGG   Ursus arctos horribilis: 113262986
Entry
113262986         CDS       T05909                                 

Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04020  Calcium signaling pathway
uah04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113262986
   04020 Calcium signaling pathway
    113262986
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    113262986
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:uah04040]
    113262986
Ion channels [BR:uah04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   113262986
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 113262986
NCBI-ProteinID: XP_026365376
UniProt: A0A3Q7VWE0
LinkDB
Position
Unknown
AA seq 1647 aa
MEKGFNFNDGTPSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFI
VLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMP
SIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQRTSQLRRHMQMSSQEALNKEEAPP
MNPLNPLNPLSPLNPLNAHPSLYRRPRPIEGLGLGLGLEKCEEERISRGGSLKGDGGDLS
SALDNQRSPLSLGKREPPWLARPCHGNCDPTQQEAGGGETVVTFEDRARHRQSQRRSRHR
RVRTESKELSSTSRSRSASQERSLDEGVPTEGEKDREPRGSHAGKEPTIQEEQRGQDLRR
TNSLMVPRGSGLAGALDEASTPLVLAQPELEVGKDMALTEQEAEGSSEQALLGDVQLDMG
RAISQSEPDLSCTTANTDKATTDSTSITVAIPDVGPLVDSTVVHISNKTDGEASPLKEAE
IKEEEEEVEKKQQKKEKRETGKAMVPHSSMFIFSTTNPIRRACHYIVSLRYFEMCILLVI
AASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWN
ILDFVVVVGALVAFALANALGTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVV
TSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSKDTEKECIGNYVDHEKNKMEV
KGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFY
VVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQN
RHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYYSAPCTYELALKYLNIAFTMVFSL
ECVLKIIAFGFLNYFRDTWNIFDFITVIGSITEIILTDSKLVNTSGFNMSFLKLFRAARL
IKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRH
NNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGCEPDTTAPSGQNENERCGTDLAYVYF
VSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRVWAEYDRAACGRIHYTE
MYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAK
GGADRQQLDSELQKETLAIWPHLSQKMLDLLVPMPKASDLTVGKIYAAMMIMDYYKQSKV
KKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKALPYLQQDPVSGLSGRSGYPSMSPLSP
QEIFQLACMDPADDGQFQEQQSLVVTDPTSMRRSFSTIRDKRSNSSWLEEFSMERSSENT
YKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGRERGRSKERKHLLSPDVSRCNSEERG
TQADWESPERQQSRSPSEGRSQTPNQQGTGSLSESSIPSVSDTSTPRRSRRQLPPVPPKP
RPLLSYSSLLRHTGSISPPADGSEGGSPLTSQALESTEPGLVEASSSRHVPQGQHSSPQR
YISEPYLALHEDSHASDCGEEETLTFEAAVATSLGRSNTIGSAPPLRHSWQMPNGHYRRR
RRGGPGPGVMCGAVSDLLSDTEEDDKC
NT seq 4944 nt   +upstreamnt  +downstreamnt
atggagaaagggtttaactttaatgatgggactccttcagcaaactttgacaccttccct
gcagccatcatgactgtattccagatcctaacaggggaggactggaatgaggtgatgtac
aatgggatccgctcccagggtggggtgagctcaggcatgtggtcagctatctatttcatt
gtgctcaccttgtttggaaactacacactgctgaatgttttcttggccattgctgtggac
aatctggccaatgcccaagagctgaccaaggatgagcaagaagaagaggaggctttcaac
cagaaacatgcgttgcagaaggccaaggaggtcagcccgatgtctgcacccaacatgcct
tctatcgaaagagacagaaggagaagacaccacatgtcgatgtgggagccacgcagcagc
cacctgagggaacggaggcgccggcaccacatgtcggtgtgggagcagcgcaccagccag
ctgagaaggcacatgcagatgtccagccaggaggccctcaataaagaggaggccccacca
atgaaccccctcaaccccctcaacccgctgagccccctcaacccactcaatgcccacccc
agcctctaccggagacccaggcccatcgagggcctgggcttgggcctgggcctggagaag
tgtgaggaggaacgcatcagccgtggggggtccctcaagggggatggaggggacctgtcg
agtgccctagacaaccagaggagccccttgtccctgggcaaacgggagccaccgtggctg
gccaggccctgtcatggcaactgtgatccgacccagcaggaggctgggggaggggagacc
gtggtgaccttcgaggaccgcgccaggcacaggcagagccagcggcgcagccggcaccgt
cgtgtcaggacagaaagcaaggagctctcctccacctcccggagcaggtctgccagccag
gagcggagtctggatgagggggtacccaccgagggggagaaggaccgcgagcccaggggc
agccatgcgggcaaggagcccacaatccaggaagaacagagaggccaagacttaaggagg
accaacagtctgatggtgcccagaggctccgggctggcaggagcccttgatgaggccagc
acgcccctggtcctggcccagccagagctggaagtggggaaggatatggcactgacggag
caggaggcggagggcagcagtgagcaggccctgctgggcgacgtgcagttggacatgggc
agggccatcagccagagtgagcctgacctctcctgcaccacggccaacacagacaaggcc
accaccgacagcaccagcatcaccgtcgccatccccgacgtgggccccttggtggactca
actgtggttcacattagcaacaagactgatggagaagccagtcccttgaaggaggcagag
atcaaagaggaggaggaggaggtggagaagaagcagcagaaaaaggagaagcgtgagacg
ggcaaagccatggtgccccacagctccatgttcatcttcagcaccaccaacccgatccgc
agggcctgccactacatcgtgagcctgcgctactttgagatgtgcattctcctggtgatc
gcggccagcagcatcgccttggcagccgaggaccccgtcctgaccaactcggagcgcaac
aaagtcctgaggtattttgactatgttttcactggcgtgttcacctttgagatggttata
aagatgatagaccagggcttgatcctgcaggacgggtcctacttccgagacctgtggaac
atcctggactttgtggtggttgttggcgcattggtggcctttgctttggcgaacgctttg
ggaacaaacaaggggcgagacatcaagaccatcaaatctctgcgggtcctccgagttctg
aggccactgaagaccatcaagcgcttgcccaagctcaaggctgtttttgactgtgtggtg
acctccttgaagaatgtcttcaacatcctcattgtctacaagctcttcatgttcatcttt
gctgtcattgcggttcagctcttcaagggaaaattcttttattgcacagacagttccaaa
gacacagagaaggagtgtataggcaactatgtagatcacgaaaaaaacaagatggaggtg
aaaggccgggaatggaagcgccatgaattccactacgacaacattatctgggccctgctg
accctcttcaccgtctccacaggggaaggatggcctcaagtcttacagcactctgtcgat
gtgacagaggaagaccgaggaccaagccgcagcaaccgcatggagatgtccatcttttac
gtggtctactttgtggtcttccctttcttctttgtcaatatctttgtggctctcatcatc
atcaccttccaggagcaaggagacaagatgatggaggagtgtagcctggagaagaatgag
agagcgtgcatcgacttcgccatcagtgccaaacccctcacccgctacatgccgcagaac
aggcacacgttccagtaccgggtctggcactttgtggtgtccccgtccttcgagtatacc
atcatggccatgattgccttgaacaccgtcgtgctgatgatgaagtactactctgctccc
tgtacctacgaactggccctgaagtacctgaatattgccttcaccatggtgttctccctg
gagtgtgtcctgaagatcatcgcgtttggcttcttgaactattttcgagacacctggaat
atctttgacttcatcaccgtgattggcagtatcacagaaatcattctgacggacagcaag
ctggtgaataccagtggcttcaatatgagctttctgaagctcttccgagccgcccgcctc
atcaagcttctacggcagggctacaccatccgaattttactttggacctttgtgcagtcc
tttaaggccctcccctacgtctgccttttgattgccatgcttttcttcatctatgccatc
attgggatgcaggtatttggaaacataaaattagatgaggagagtcacatcaaccggcac
aacaacttccggagtttctttgggtccctcatgttactcttcaggagtgccacaggtgag
gcctggcaggagataatgctgtcgtgccttggggagaaaggctgcgaacccgacaccacc
gcgccttcagggcagaacgagaatgagcgctgtggcacagacctggcctacgtttacttt
gtctccttcatcttcttctgctctttcttgatgctcaacctgttcgtggccgtcatcatg
gacaactttgagtacctgactcgggactcctccatcttagggcctcaccacttggacgag
tttgtccgcgtctgggcggaatatgacagagctgcatgtggccgcatccattacactgag
atgtatgaaatgctgactctcatgtcaccaccgctaggcctcggcaagagatgtccctcc
aaagtggcatataagaggttggtcctgatgaatatgccagtagccgaggacatgaccgtc
cacttcacctccacacttatggctctgatccggacagctctggacatcaaaatcgccaaa
ggtggtgcagacaggcagcagctagactcggagctgcaaaaggagaccctggccatttgg
ccccacctgtcccagaagatgctagatctgcttgtgcccatgcccaaagcctctgacctg
actgtgggcaaaatctatgcagcaatgatgatcatggactactataaacagagtaaggtg
aagaagcagaggcagcagctggaggaacagaaaaatgcacccatgttccagcgcatggag
ccctcatctctgcctcaggagatcattgctaatgccaaagccctgccctatctccagcag
gaccctgtttcaggcctgagcggccgtagtggatacccttcgatgagtccgctctccccc
caggaaatattccagttggcttgtatggacccagccgatgatggacagttccaggaacag
cagtctctggtggtgacagatcctacctccatgagacgttcattttccacgattcgggat
aagcgttcaaattcctcatggttggaggaattctccatggagagaagtagcgaaaacacc
tacaagtcacgtcgccggagttaccactcctcgctgagactgtcagctcatcgcctgaat
tctgactcaggccacaagtctgacacccaccgctcagggggcagagagcggggacggtca
aaagagcgaaagcatcttctctctcccgacgtctcccgctgcaactcagaggagcgaggg
actcaggccgactgggagtccccggagcgccagcagtccaggtctcccagtgagggcagg
tcgcagacccccaaccaacagggcacaggctccctgagtgaaagctccatcccctccgtc
tctgacaccagcaccccaagacgaagtcgccggcagctcccccctgttccaccaaagcct
cggcccctcctttcctacagctccctgctgcgccacaccggaagcatctctcccccagct
gatggaagcgagggtggctccccgctgacctcccaggcgctggagagcacagagcctggc
ctggtggaggcttccagctcccggcatgtcccgcagggccagcactcctccccacagcgc
tacatctccgagccctacctggccctgcacgaagactcccacgcctcagactgtggcgag
gaggagacgctcaccttcgaagccgccgtggccaccagcctgggccgctccaacaccatc
ggctcagcgccaccgctgcggcacagctggcagatgcccaacgggcactatcggcggcgg
cggcgcgggggaccagggccaggtgtgatgtgtggggctgtcagcgacctcctgagtgac
acggaagaagacgacaagtgctag

DBGET integrated database retrieval system