KEGG   Ursus arctos horribilis: 113263086Help
Entry
113263086         CDS       T05909                                 

Gene name
EREG
Definition
(RefSeq) proepiregulin
  KO
K09784  epiregulin
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04012  ErbB signaling pathway
uah04151  PI3K-Akt signaling pathway
uah05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113263086 (EREG)
   04012 ErbB signaling pathway
    113263086 (EREG)
   04151 PI3K-Akt signaling pathway
    113263086 (EREG)
 09160 Human Diseases
  09162 Cancer: specific types
   05210 Colorectal cancer
    113263086 (EREG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF DUF2207 OAD_gamma Sec66
Motif
Other DBs
NCBI-GeneID: 113263086
NCBI-ProteinID: XP_026365411
UniProt: A0A3Q7VWI0
LinkDB All DBs
Position
Unknown
AA seq 177 aa AA seqDB search
MEEGLWLCGSLIKVSFPEGRVYIFGFLPSIGFHLLQAVLGTTVIPSCIPGESEDNCTALV
RIEDNPRVAQVSITKCGSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVQQ
PLSKEYVALTVILILLFLVIVAGSIYYFCRWYRNRKSKEPKKDYERVTSGDPALPQV
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaggactgtggttatgtggaagtctgatcaaggtttctttccctgaaggacgt
gtttatatatttggttttctcccatcaataggtttccatcttctccaagcagttctgggc
accactgtgattccttcctgcatcccgggagaatccgaagataactgcacggcgttagtt
cggatagaagacaatccacgtgtggctcaagtatccataacgaagtgtggctctgacatg
aacggctactgtttgcacggacagtgcatctacctggtggacatgagtcagaattactgc
aggtgtgaagtggggtacactggtgtccgatgcgagcacttctttttaaccgtccaacag
cccttgagcaaagaatacgtggctttgactgtgattctcattctcttgtttcttgtcata
gttgctggttccatatactacttctgcagatggtacagaaatcgaaaaagtaaagagccc
aagaaggactacgaaagggtgacgtcaggggacccagcattgcctcaagtctga

DBGET integrated database retrieval system