KEGG   Ursus arctos horribilis: 113263257
Entry
113263257         CDS       T05909                                 

Gene name
CXCL9
Definition
(RefSeq) C-X-C motif chemokine 9 isoform X1
  KO
K05416  C-X-C motif chemokine 9
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04062  Chemokine signaling pathway
uah04620  Toll-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113263257 (CXCL9)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113263257 (CXCL9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113263257 (CXCL9)
   04062 Chemokine signaling pathway
    113263257 (CXCL9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113263257 (CXCL9)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Chemokines
   113263257 (CXCL9)
SSDB
Motif
Pfam: IL8 VasL
Other DBs
NCBI-GeneID: 113263257
NCBI-ProteinID: XP_026365724
UniProt: A0A3Q7XH47
LinkDB
Position
Unknown
AA seq 153 aa
MKKGGVPLLLSIIFLTLIGGEGTPTMRNRRCSCITTSQRTIQLKFLKDLKQFAPNSSCEK
IEIIATMKNGDQTCLNPDSADVKELIKEWEKQPQTQTFHTGRNLTGGSTMKILEMKILLV
CLPHIGRVVLTSLMASLSSSLLICKLSMRDCDL
NT seq 462 nt   +upstreamnt  +downstreamnt
atgaagaaaggtggtgttcctcttttgttgagtatcatcttcctgactctgattggaggt
gaaggaaccccaacaatgaggaatagacgttgttcctgtatcaccaccagccaaagaaca
atccagttgaagttcttaaaggaccttaaacaatttgccccaaattcttcctgtgagaaa
attgaaatcattgcaacaatgaagaatggggatcaaacatgtctaaacccagattcagca
gatgtgaaagaactgattaaagagtgggaaaaacagccccaaacgcagacttttcacact
gggagaaaccttacaggtggaagtacaatgaagattctggaaatgaagatattactggtc
tgcctgccacacattggccgagtagttttgacaagtctcatggcctctctgagtagcagt
ttactcatctgtaaactaagcatgagggactgtgatctctaa

DBGET integrated database retrieval system