KEGG   Ursus arctos horribilis: 113264818
Entry
113264818         CDS       T05909                                 

Gene name
MAP3K7
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 7 isoform X1
  KO
K04427  mitogen-activated protein kinase kinase kinase 7 [EC:2.7.11.25]
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04064  NF-kappa B signaling pathway
uah04140  Autophagy - animal
uah04152  AMPK signaling pathway
uah04310  Wnt signaling pathway
uah04380  Osteoclast differentiation
uah04520  Adherens junction
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04657  IL-17 signaling pathway
uah04660  T cell receptor signaling pathway
uah04668  TNF signaling pathway
uah05132  Salmonella infection
uah05135  Yersinia infection
uah05140  Leishmaniasis
uah05145  Toxoplasmosis
uah05161  Hepatitis B
uah05162  Measles
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113264818 (MAP3K7)
   04310 Wnt signaling pathway
    113264818 (MAP3K7)
   04064 NF-kappa B signaling pathway
    113264818 (MAP3K7)
   04668 TNF signaling pathway
    113264818 (MAP3K7)
   04152 AMPK signaling pathway
    113264818 (MAP3K7)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113264818 (MAP3K7)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    113264818 (MAP3K7)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113264818 (MAP3K7)
   04621 NOD-like receptor signaling pathway
    113264818 (MAP3K7)
   04622 RIG-I-like receptor signaling pathway
    113264818 (MAP3K7)
   04660 T cell receptor signaling pathway
    113264818 (MAP3K7)
   04657 IL-17 signaling pathway
    113264818 (MAP3K7)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113264818 (MAP3K7)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113264818 (MAP3K7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113264818 (MAP3K7)
   05135 Yersinia infection
    113264818 (MAP3K7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113264818 (MAP3K7)
   05162 Measles
    113264818 (MAP3K7)
   05161 Hepatitis B
    113264818 (MAP3K7)
   05168 Herpes simplex virus 1 infection
    113264818 (MAP3K7)
   05169 Epstein-Barr virus infection
    113264818 (MAP3K7)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113264818 (MAP3K7)
   05140 Leishmaniasis
    113264818 (MAP3K7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113264818 (MAP3K7)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     113264818 (MAP3K7)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: TKL group
  MLK family
   113264818 (MAP3K7)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase APH
Other DBs
NCBI-GeneID: 113264818
NCBI-ProteinID: XP_026367584
UniProt: A0A3Q7XLS9
LinkDB
Position
Unknown
AA seq 606 aa
MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDV
AIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAE
PLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTAC
DIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM
WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQY
PCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQ
SESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIAATTAYSKPKRGHRKTASFGN
ILDVPEIVISGNGQPRRRSIQDLTVTGTEPGQVSSRSSSPSVRMITTSGPTSEKPTRSHP
WTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEI
ALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQ
KRQGTS
NT seq 1821 nt   +upstreamnt  +downstreamnt
atgtctacagcctccgccgcttcctcctcttcctcgtcttcggccggtgagatgatcgaa
gccccctcccaagtcctcaacttcgaagagatcgactacaaggagatcgaggtagaagag
gttgttggaagaggagcctttggagtggtttgcaaagctaagtggagagcaaaagatgtt
gctattaaacaaatagaaagtgaatctgagaggaaagcttttattgtagagcttcgacag
ttatcccgtgtgaaccatcctaatattgtaaagctatatggagcctgcttgaatccagtg
tgtcttgtgatggaatatgctgaagggggctctttatataatgtgctgcatggtgctgaa
ccattgccatattacactgctgcccatgcaatgagttggtgtttacagtgttcccaagga
gtggcttatcttcacagcatgcaacccaaagctctaattcacagggacctgaaaccacca
aacttgctgctggttgcaggtgggacagtattaaaaatctgtgactttggtacagcctgt
gacattcagactcatatgaccaataacaaggggagtgctgcttggatggcacctgaagtt
tttgaaggtagcaattacagtgaaaaatgtgatgtcttcagctggggtattatcctttgg
gaagtgataacacgtcggaaaccctttgatgagattggtggcccagctttccgtatcatg
tgggctgttcataacggtactcgaccaccactgatcaaaaatttacctaagcccattgag
agcctgatgactcgttgttggtctaaagatccttctcagcgcccttcaatggaggaaatt
gtgaaaataatgactcacttgatgcggtactttccaggagcagatgagccattacagtat
ccttgtcagtattcagatgaaggacagagcaactctgccaccagtacaggctcattcatg
gacattgcttctacaaataccagtaataaaagtgacactaatatggagcaagttcctgcc
acaaatgatactattaaacgcttagaatcaaaactgttgaaaaatcaggcaaagcaacag
agtgaatcaggacgtttaagcttgggagcttcccgtgggagcagtgtggagagcttgccc
ccaacctccgagggcaagaggatgagtgctgacatgtctgaaatagaagccaggattgct
gcaaccacagcctattccaagcctaaacggggccaccgtaaaactgcttcatttggcaac
attctggatgtccctgagatcgtcatatcaggcaacggacaaccaagacgtagatccatc
caagacttgactgtcactggaacagaacctggtcaggtaagcagtaggtcatccagtcct
agtgtcagaatgatcactacctcaggaccaacctcagaaaagccaactcgaagtcatcca
tggactcctgatgattccacagataccaatggatcagataactctatcccaatggcttat
cttacactggatcaccaactacagcctctagcaccgtgcccaaactccaaagaatctatg
gcagtgtttgaacagcattgtaaaatggcacaagaatatatgaaagttcaaacagaaatt
gcattgttattacagagaaagcaagaactagttgcagaactggaccaggatgaaaaggac
cagcaaaatacatctcgtctggtacaggaacataaaaagcttttagatgaaaacaaaagc
ctttctacttactaccagcaatgcaaaaaacaactagaggtcatcagaagtcagcagcaa
aagcgacaaggcacttcatga

DBGET integrated database retrieval system