KEGG   Ursus arctos horribilis: 113264990
Entry
113264990         CDS       T05909                                 

Gene name
CREB3L1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
uah  Ursus arctos horribilis
Pathway
uah04022  cGMP-PKG signaling pathway
uah04024  cAMP signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04152  AMPK signaling pathway
uah04211  Longevity regulating pathway
uah04261  Adrenergic signaling in cardiomyocytes
uah04668  TNF signaling pathway
uah04714  Thermogenesis
uah04725  Cholinergic synapse
uah04728  Dopaminergic synapse
uah04911  Insulin secretion
uah04915  Estrogen signaling pathway
uah04916  Melanogenesis
uah04918  Thyroid hormone synthesis
uah04922  Glucagon signaling pathway
uah04925  Aldosterone synthesis and secretion
uah04926  Relaxin signaling pathway
uah04927  Cortisol synthesis and secretion
uah04928  Parathyroid hormone synthesis, secretion and action
uah04931  Insulin resistance
uah04934  Cushing syndrome
uah04935  Growth hormone synthesis, secretion and action
uah04962  Vasopressin-regulated water reabsorption
uah05016  Huntington disease
uah05030  Cocaine addiction
uah05031  Amphetamine addiction
uah05034  Alcoholism
uah05161  Hepatitis B
uah05163  Human cytomegalovirus infection
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05203  Viral carcinogenesis
uah05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    113264990 (CREB3L1)
   04024 cAMP signaling pathway
    113264990 (CREB3L1)
   04022 cGMP-PKG signaling pathway
    113264990 (CREB3L1)
   04151 PI3K-Akt signaling pathway
    113264990 (CREB3L1)
   04152 AMPK signaling pathway
    113264990 (CREB3L1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    113264990 (CREB3L1)
   04922 Glucagon signaling pathway
    113264990 (CREB3L1)
   04915 Estrogen signaling pathway
    113264990 (CREB3L1)
   04926 Relaxin signaling pathway
    113264990 (CREB3L1)
   04935 Growth hormone synthesis, secretion and action
    113264990 (CREB3L1)
   04918 Thyroid hormone synthesis
    113264990 (CREB3L1)
   04928 Parathyroid hormone synthesis, secretion and action
    113264990 (CREB3L1)
   04916 Melanogenesis
    113264990 (CREB3L1)
   04925 Aldosterone synthesis and secretion
    113264990 (CREB3L1)
   04927 Cortisol synthesis and secretion
    113264990 (CREB3L1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    113264990 (CREB3L1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    113264990 (CREB3L1)
  09156 Nervous system
   04725 Cholinergic synapse
    113264990 (CREB3L1)
   04728 Dopaminergic synapse
    113264990 (CREB3L1)
  09149 Aging
   04211 Longevity regulating pathway
    113264990 (CREB3L1)
  09159 Environmental adaptation
   04714 Thermogenesis
    113264990 (CREB3L1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    113264990 (CREB3L1)
  09162 Cancer: specific types
   05215 Prostate cancer
    113264990 (CREB3L1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    113264990 (CREB3L1)
  09165 Substance dependence
   05030 Cocaine addiction
    113264990 (CREB3L1)
   05031 Amphetamine addiction
    113264990 (CREB3L1)
   05034 Alcoholism
    113264990 (CREB3L1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    113264990 (CREB3L1)
   04934 Cushing syndrome
    113264990 (CREB3L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113264990 (CREB3L1)
   05161 Hepatitis B
    113264990 (CREB3L1)
   05163 Human cytomegalovirus infection
    113264990 (CREB3L1)
   05165 Human papillomavirus infection
    113264990 (CREB3L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:uah03000]
    113264990 (CREB3L1)
Transcription factors [BR:uah03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    113264990 (CREB3L1)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf LMBR1 ELP6 Jnk-SapK_ap_N Spc29 Prominin TPR_MLP1_2 APG6_N HAUS-augmin3 JMY RNase_Y_N DUF4404 ADIP DUF724
Other DBs
NCBI-GeneID: 113264990
NCBI-ProteinID: XP_026367815
UniProt: A0A3Q7WRY1
LinkDB
Position
Unknown
AA seq 520 aa
MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFAENMEDFSNDLFSSFFD
DPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDVEHGAWVLG
HKLCSVMVKQEQSPELPVDPLAASSAMAAAAAMATTPLLGLSPLSRLPVPHQAPGEMTQP
PVIKAEPQEVTQFLKVTPEDLVQMPLTPPSSHGSDSDGSQSPRSLPPSSPVRPMARSSTA
ISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKN
KISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANRTLLQQLQKLQTLVTNK
ISRPYKMAATQTGTCLMVAALCFVLVLGSLVPCLPEFSSSSQTVKEDPMATDSVYTASQM
PSRSLLFYDEGAGSWEDGRSALLPVEPPDGWEIKPGGPAEPRPQDHLQHDHLDSSHETTK
YLSEAWPKDVGGNGTSPDFSHPKEWFRERDLGPNTTIKLS
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggacgccgtcttggagcccttcccggccgacaggctgttccccggatccagcttcctg
gacttgggggatctgaacgagtcggatttcctcaacaatgcgcacttcccggagcacctg
gaccactttgcggagaacatggaggacttctccaacgatctgttcagcagcttctttgat
gaccccgtgctggacgagaagagccctctactggacatggaactggactcccccacacca
ggcatccaggctgagcacagctactccctgagtggtgactcggcgcctcagagtcccctt
gtgcccatcaagatggaggacaccacccaagacgtggaacacggagcatgggtgctggga
cacaaactgtgctccgtcatggtgaagcaggagcagagcccggagctgcccgtggaccct
ctggccgcctcttcagccatggccgctgctgccgccatggccaccactccgctgctgggc
ctcagccccctgtccaggctgcctgtcccccaccaggccccaggagagatgacgcagccg
ccagtgatcaaagcagagccccaggaggtgactcagttcctcaaagtgacaccagaggac
ctggtgcagatgcctctgacgccccccagcagccacggcagcgacagtgacggctcccag
agtccccgctctctgcccccctccagccctgtccggcccatggcccgctcctccacggcc
atctccacctccccccttctcaccgcccctcacaaattacaggggacatcagggccactg
ctcctgacagaggaggagaaacgcaccctgattgctgagggctaccccatccccacgaaa
ctccccctcaccaaagctgaagaaaaggccttaaagagggtccggagaaaaatcaagaat
aagatctcggcccaggagagccgccgtaagaagaaggagtacgtggaatgtctagaaaag
aaggtggagacgtttacatcagagaacaacgaactgtggaagaaggtagagaccctggag
aatgccaacaggaccctgctccagcagctgcagaaactccagactctggtcaccaacaag
atctcaagaccttacaagatggccgccacccagactgggacctgcctcatggtggcagcc
ttgtgcttcgttctggtgctgggctccctcgtgccctgcctccctgagttctcctccagc
tcccagactgtgaaggaagaccccatggccacagacagcgtgtacacagccagtcagatg
ccctcccggagcctcctgttctacgacgagggggcaggctcgtgggaggatggccgcagt
gccctgctgcctgtggagcccccagatggctgggaaatcaagccgggggggccggccgag
cctcggccccaggaccacctgcagcatgaccacctggacagcagtcatgagaccaccaag
tacctgagtgaggcctggccaaaagacgtcggtggaaacggcaccagccccgacttctct
caccccaaggagtggttccgtgagagggatctgggccccaataccaccatcaaactctcc
tag

DBGET integrated database retrieval system