KEGG   Ursus arctos horribilis: 113265227
Entry
113265227         CDS       T05909                                 

Gene name
MAP2K6
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 6
  KO
K04433  mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04015  Rap1 signaling pathway
uah04218  Cellular senescence
uah04380  Osteoclast differentiation
uah04620  Toll-like receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04668  TNF signaling pathway
uah04750  Inflammatory mediator regulation of TRP channels
uah04912  GnRH signaling pathway
uah04935  Growth hormone synthesis, secretion and action
uah05014  Amyotrophic lateral sclerosis (ALS)
uah05132  Salmonella infection
uah05135  Yersinia infection
uah05145  Toxoplasmosis
uah05161  Hepatitis B
uah05163  Human cytomegalovirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    113265227 (MAP2K6)
   04010 MAPK signaling pathway
    113265227 (MAP2K6)
   04668 TNF signaling pathway
    113265227 (MAP2K6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    113265227 (MAP2K6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113265227 (MAP2K6)
   04664 Fc epsilon RI signaling pathway
    113265227 (MAP2K6)
  09152 Endocrine system
   04912 GnRH signaling pathway
    113265227 (MAP2K6)
   04935 Growth hormone synthesis, secretion and action
    113265227 (MAP2K6)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    113265227 (MAP2K6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113265227 (MAP2K6)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113265227 (MAP2K6)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    113265227 (MAP2K6)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113265227 (MAP2K6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113265227 (MAP2K6)
   05135 Yersinia infection
    113265227 (MAP2K6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113265227 (MAP2K6)
   05161 Hepatitis B
    113265227 (MAP2K6)
   05163 Human cytomegalovirus infection
    113265227 (MAP2K6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113265227 (MAP2K6)
   05169 Epstein-Barr virus infection
    113265227 (MAP2K6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113265227 (MAP2K6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113265227 (MAP2K6)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     113265227 (MAP2K6)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: STE group
  STE7 family
   113265227 (MAP2K6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal CLP1_P Choline_kinase DUF4344 APH
Other DBs
NCBI-GeneID: 113265227
NCBI-ProteinID: XP_026368143
UniProt: A0A3Q7X1M6
LinkDB
Position
Unknown
AA seq 334 aa
MSQSKGRKRNPGLKIPKEAFEQPQPSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELG
RGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALF
REGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDV
KPSNVLINTLGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDI
WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSEEFVDFTSQCLKKNSK
ERPTYPELMEHPFFTLHESKATDVASFVKLILGD
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgtctcagtcgaaaggcaggaagcgaaaccctggccttaagattccaaaggaagcattt
gaacaacctcagcccagttccacgccacctcgagacttagactctaaagcttgcatttct
attggaaatcagaactttgaggtgaaggccgatgacctggagcccataatggaactgggg
cgaggtgcgtacggggtggtggagaagatgcgacacgtgcccagcgggcagatcatggcg
gtgaagcggatccgggccacagtaaatagccaggagcagaaaaggctactgatggatttg
gatatttccatgaggacagtggactgtcctttcaccgtcaccttttatggtgccctcttc
cgggagggtgacgtttggatctgtatggagctcatggatacgtcgctagataaattctac
aaacaagtgattgataaaggccaaacaattccagaggacatcttagggaaaatagcagtt
tctattgtaaaagcattagaacacttacacagtaagctctctgtcattcatcgagacgtc
aagccttccaacgtgctgatcaacactctgggccaagtgaagatgtgcgattttggaatc
agtggctaccttgtggactctgtggctaaaactattgatgcaggatgcaaaccgtacatg
gcccctgaaagaataaacccagagctcaatcagaagggctacagtgtgaagtctgacatt
tggagtctgggcatcacaatgattgagttggcaatccttcggtttccctacgactcttgg
ggaactcccttccagcagctcaaacaggtggtggaggaaccctcgccacaactcccggcg
gacaaattctccgaagagtttgttgactttacctcacagtgcttgaagaagaattccaaa
gaacggccgacatatccagaacttatggaacatccatttttcaccctgcacgaatccaaa
gcaacagacgtggcatcttttgtaaaactgattcttggagactaa

KEGG   Ursus arctos horribilis: 113271318
Entry
113271318         CDS       T05909                                 

Gene name
MAP2K3
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 3
  KO
K04432  mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04015  Rap1 signaling pathway
uah04218  Cellular senescence
uah04620  Toll-like receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04668  TNF signaling pathway
uah04714  Thermogenesis
uah04750  Inflammatory mediator regulation of TRP channels
uah04912  GnRH signaling pathway
uah04935  Growth hormone synthesis, secretion and action
uah05014  Amyotrophic lateral sclerosis (ALS)
uah05132  Salmonella infection
uah05135  Yersinia infection
uah05145  Toxoplasmosis
uah05161  Hepatitis B
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    113271318 (MAP2K3)
   04010 MAPK signaling pathway
    113271318 (MAP2K3)
   04668 TNF signaling pathway
    113271318 (MAP2K3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    113271318 (MAP2K3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113271318 (MAP2K3)
   04664 Fc epsilon RI signaling pathway
    113271318 (MAP2K3)
  09152 Endocrine system
   04912 GnRH signaling pathway
    113271318 (MAP2K3)
   04935 Growth hormone synthesis, secretion and action
    113271318 (MAP2K3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    113271318 (MAP2K3)
  09159 Environmental adaptation
   04714 Thermogenesis
    113271318 (MAP2K3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113271318 (MAP2K3)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    113271318 (MAP2K3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113271318 (MAP2K3)
   05135 Yersinia infection
    113271318 (MAP2K3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113271318 (MAP2K3)
   05161 Hepatitis B
    113271318 (MAP2K3)
   05169 Epstein-Barr virus infection
    113271318 (MAP2K3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113271318 (MAP2K3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113271318 (MAP2K3)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     113271318 (MAP2K3)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: STE group
  STE7 family
   113271318 (MAP2K3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal Seadorna_VP7 APH Choline_kinase RIO1 DUF4344
Other DBs
NCBI-GeneID: 113271318
NCBI-ProteinID: XP_026376982
UniProt: A0A3Q7YAQ0
LinkDB
Position
Unknown
AA seq 347 aa
MESPDSSQPASMPQTKGKSKRKKDLRISCLSKPPVPNPTPPRNLDSRTFITIGDRNFEVE
ADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDC
FYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSVVRALEHL
HSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTLDAGCKPYMAPERINPEL
NQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVD
FTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggagtcgcccgactccagtcagccggccagcatgccccagaccaaagggaaatccaaa
aggaagaaggatttacggatatcctgcctgtccaagccgcccgtacccaaccccacaccc
ccccggaacctggactcccggaccttcatcaccatcggagacaggaactttgaggtggag
gccgatgacctggtgaccatctccgagctgggccgcggagcctatggggtggtggagaag
gtgcggcatgcccagagcggcaccatcatggccgtcaagcggatccgggccaccgtgaac
tcacaggagcagaagcgtctgctcatggacttggacatcaacatgcgtacggtcgactgc
ttctacaccgtcaccttctatggggccctcttcagagagggagatgtgtggatctgcatg
gagctcatggacacatccctggacaagttctaccggaaggtgctcgataaaaacatgacc
attccagaggacatcctgggggaaattgctgtgtctgtcgtgagggcgttggaacacctg
cacagcaagttgtccgtgatccacagagacgtgaagccgtccaatgtcctcatcaacaag
gagggtcacgtgaagatgtgtgacttcggtatcagtggctacttggtggattctgtggcc
aagacgctggacgctggctgcaagccctacatggctcccgagagaatcaacccggagctg
aaccagaaaggctacaacgtcaagtccgacgtctggagcctcggcatcaccatgatcgag
atggccatcctccgctttccgtatgaatcctgggggactccgttccagcagctgaagcag
gtcgtagaggagccgtctccccagctccccgccgaccgtttctctcctgagtttgtggac
ttcactgcgcagtgcttgagaaagaaccccgcggagcgcatgagctacttggagctgatg
gagcacccgttcttcacattgcacaaaaccaagaagacggacattgctgcctttgtgaag
gagatcctgggggaggactcgtag

DBGET integrated database retrieval system