KEGG   Ursus arctos horribilis: 113265250
Entry
113265250         CDS       T05909                                 

Gene name
PRKCA
Definition
(RefSeq) protein kinase C alpha type
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah04010  MAPK signaling pathway
uah04012  ErbB signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04020  Calcium signaling pathway
uah04066  HIF-1 signaling pathway
uah04070  Phosphatidylinositol signaling system
uah04071  Sphingolipid signaling pathway
uah04072  Phospholipase D signaling pathway
uah04150  mTOR signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04261  Adrenergic signaling in cardiomyocytes
uah04270  Vascular smooth muscle contraction
uah04310  Wnt signaling pathway
uah04360  Axon guidance
uah04370  VEGF signaling pathway
uah04510  Focal adhesion
uah04540  Gap junction
uah04650  Natural killer cell mediated cytotoxicity
uah04664  Fc epsilon RI signaling pathway
uah04666  Fc gamma R-mediated phagocytosis
uah04670  Leukocyte transendothelial migration
uah04713  Circadian entrainment
uah04720  Long-term potentiation
uah04723  Retrograde endocannabinoid signaling
uah04724  Glutamatergic synapse
uah04725  Cholinergic synapse
uah04726  Serotonergic synapse
uah04727  GABAergic synapse
uah04728  Dopaminergic synapse
uah04730  Long-term depression
uah04750  Inflammatory mediator regulation of TRP channels
uah04911  Insulin secretion
uah04912  GnRH signaling pathway
uah04916  Melanogenesis
uah04918  Thyroid hormone synthesis
uah04919  Thyroid hormone signaling pathway
uah04921  Oxytocin signaling pathway
uah04925  Aldosterone synthesis and secretion
uah04926  Relaxin signaling pathway
uah04928  Parathyroid hormone synthesis, secretion and action
uah04929  GnRH secretion
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah04935  Growth hormone synthesis, secretion and action
uah04960  Aldosterone-regulated sodium reabsorption
uah04961  Endocrine and other factor-regulated calcium reabsorption
uah04970  Salivary secretion
uah04971  Gastric acid secretion
uah04972  Pancreatic secretion
uah05017  Spinocerebellar ataxia
uah05031  Amphetamine addiction
uah05032  Morphine addiction
uah05143  African trypanosomiasis
uah05146  Amoebiasis
uah05161  Hepatitis B
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05205  Proteoglycans in cancer
uah05206  MicroRNAs in cancer
uah05214  Glioma
uah05223  Non-small cell lung cancer
uah05225  Hepatocellular carcinoma
uah05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113265250 (PRKCA)
   04015 Rap1 signaling pathway
    113265250 (PRKCA)
   04010 MAPK signaling pathway
    113265250 (PRKCA)
   04012 ErbB signaling pathway
    113265250 (PRKCA)
   04310 Wnt signaling pathway
    113265250 (PRKCA)
   04370 VEGF signaling pathway
    113265250 (PRKCA)
   04066 HIF-1 signaling pathway
    113265250 (PRKCA)
   04020 Calcium signaling pathway
    113265250 (PRKCA)
   04070 Phosphatidylinositol signaling system
    113265250 (PRKCA)
   04072 Phospholipase D signaling pathway
    113265250 (PRKCA)
   04071 Sphingolipid signaling pathway
    113265250 (PRKCA)
   04151 PI3K-Akt signaling pathway
    113265250 (PRKCA)
   04150 mTOR signaling pathway
    113265250 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113265250 (PRKCA)
   04540 Gap junction
    113265250 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    113265250 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    113265250 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    113265250 (PRKCA)
   04670 Leukocyte transendothelial migration
    113265250 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    113265250 (PRKCA)
   04929 GnRH secretion
    113265250 (PRKCA)
   04912 GnRH signaling pathway
    113265250 (PRKCA)
   04921 Oxytocin signaling pathway
    113265250 (PRKCA)
   04926 Relaxin signaling pathway
    113265250 (PRKCA)
   04935 Growth hormone synthesis, secretion and action
    113265250 (PRKCA)
   04918 Thyroid hormone synthesis
    113265250 (PRKCA)
   04919 Thyroid hormone signaling pathway
    113265250 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    113265250 (PRKCA)
   04916 Melanogenesis
    113265250 (PRKCA)
   04925 Aldosterone synthesis and secretion
    113265250 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    113265250 (PRKCA)
   04270 Vascular smooth muscle contraction
    113265250 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    113265250 (PRKCA)
   04971 Gastric acid secretion
    113265250 (PRKCA)
   04972 Pancreatic secretion
    113265250 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113265250 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    113265250 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    113265250 (PRKCA)
   04727 GABAergic synapse
    113265250 (PRKCA)
   04725 Cholinergic synapse
    113265250 (PRKCA)
   04728 Dopaminergic synapse
    113265250 (PRKCA)
   04726 Serotonergic synapse
    113265250 (PRKCA)
   04720 Long-term potentiation
    113265250 (PRKCA)
   04730 Long-term depression
    113265250 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    113265250 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    113265250 (PRKCA)
  09158 Development and regeneration
   04360 Axon guidance
    113265250 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    113265250 (PRKCA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113265250 (PRKCA)
   05206 MicroRNAs in cancer
    113265250 (PRKCA)
   05205 Proteoglycans in cancer
    113265250 (PRKCA)
   05231 Choline metabolism in cancer
    113265250 (PRKCA)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    113265250 (PRKCA)
   05214 Glioma
    113265250 (PRKCA)
   05223 Non-small cell lung cancer
    113265250 (PRKCA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    113265250 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    113265250 (PRKCA)
   05032 Morphine addiction
    113265250 (PRKCA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113265250 (PRKCA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113265250 (PRKCA)
   05164 Influenza A
    113265250 (PRKCA)
   05161 Hepatitis B
    113265250 (PRKCA)
   05163 Human cytomegalovirus infection
    113265250 (PRKCA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    113265250 (PRKCA)
   05143 African trypanosomiasis
    113265250 (PRKCA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113265250 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113265250 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113265250 (PRKCA)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     113265250 (PRKCA)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   113265250 (PRKCA)
Membrane trafficking [BR:uah04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    113265250 (PRKCA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 APH
Other DBs
NCBI-GeneID: 113265250
NCBI-ProteinID: XP_026368201
UniProt: A0A3Q7W506
LinkDB
Position
Unknown
AA seq 672 aa
MADVFPANDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTDEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNAE
LRQKFEKAKLGPAGNKVISPSEDRRQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPGKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVN
PQFVHPILQSAV
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggctgacgttttcccggccaacgactccacggcgtctcaggacgtggccaaccgcttc
gcccgcaaaggggcgctgaggcagaagaacgtgcatgaggtgaaggaccacaaattcatc
gcccgcttcttcaagcagcccaccttctgcagccactgcactgacttcatctgggggttt
gggaaacaaggcttccagtgccaagtttgctgttttgtggttcacaagaggtgccatgaa
tttgtcactttttcttgtccgggtgcggataagggacccgacaccgacgacccaagaagc
aagcacaagtttaaaatccacacttatggaagccccaccttctgtgatcactgtgggtcc
ttgctgtatggacttatccatcaagggatgaaatgtgacacctgcgacatgaacgtgcac
aaacagtgcgtgatcaacgtgcccagcctctgcgggatggaccacacggagaagaggggc
cgcatctacctgaaggcggaggtcaccgacgagaagctccacgtcaccgtacgagatgca
aaaaatctaattcctatggatccaaatgggctttcagatccttatgtgaagctgaaactt
attcctgatcccaagaatgagagcaaacagaaaaccaaaaccatccgctccacactgaac
ccccagtggaatgagtcctttacattcaaattaaaaccttcggataaagaccgacggctg
tccgtagaaatctgggactgggatcgaacaactaggaatgatttcatggggtccctttcc
tttggagtctcggagctgatgaagatgccggccagcggatggtacaagctgcttaaccaa
gaggaaggtgagtactacaatgtacccattccggaaggggacgaagaaggcaacgcggag
ctcaggcagaaattcgagaaagccaagcttggcccagctggtaacaaagtaatcagtcct
tcagaagacagaagacaaccttccaacaacctggacagagtgaaactcaccgacttcaat
ttcctcatggtgctggggaaggggagttttggaaaggtgatgcttgctgaccggaagggc
acagaggaactgtatgctatcaaaatcctgaagaaggatgtggtgattcaggatgacgac
gtggagtgcaccatggtggagaagcgagtcctagccctcctggacaagcccccgttcctg
acacagctacactcctgcttccagacagtggatcggctgtacttcgtcatggaatacgtc
aacggcggggacctcatgtaccacattcagcaagtaggaaaatttaaggaaccacaagca
gtattttatgcagcagagatttccattggattgttctttcttcataaaagaggaatcatt
tacagggatctgaagttagataatgtcatgctggattcggaagggcatatcaagattgcc
gattttgggatgtgcaaggaacacatgatggatggagtcacaaccaggaccttctgtggg
acgccagattacatcgccccagagataatcgcatatcagccgtatggaaaatccgtggac
tggtgggcctatggcgtcctgttgtatgaaatgctagccgggcagcctccctttgatggc
gaagatgaagacgagctgtttcagtccataatggagcataacgtttcttatcccaagtcc
ttgtccaaggaggccgtttccatctgcaagggactgatgaccaaacacccaggcaagcgg
ctgggttgcgggccggagggggagagggacgtgcgggaacatgccttcttccggaggatc
gactgggagaaactcgagaacagggagatccaaccacccttcaagcccaaagtgtgtggc
aaaggcgcagaaaactttgacaagttcttcacgcgagggcagcctgtcttgacaccacct
gatcagctggtcattgctaacatagaccagtctgatttcgaggggttctcgtatgtcaac
ccccagtttgtgcaccccatcttacagagcgcagtatga

DBGET integrated database retrieval system