KEGG   Ursus arctos horribilis: 113265338
Entry
113265338         CDS       T05909                                 

Gene name
GFAP
Definition
(RefSeq) glial fibrillary acidic protein isoform X1
  KO
K05640  glial fibrillary acidic protein
Organism
uah  Ursus arctos horribilis
Pathway
uah04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113265338 (GFAP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113265338 (GFAP)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:uah04812]
    113265338 (GFAP)
Membrane trafficking [BR:uah04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    113265338 (GFAP)
Cytoskeleton proteins [BR:uah04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type III
     113265338 (GFAP)
SSDB
Motif
Pfam: Filament Filament_head DUF1664 Spc7 DUF573 Topoisom_I_N GAS T6PP_N
Other DBs
NCBI-GeneID: 113265338
NCBI-ProteinID: XP_026368420
UniProt: A0A3Q7WTQ2
LinkDB
Position
Unknown
AA seq 432 aa
MERRRVTSAARRSYVSSSDVVGGSLVSGRRLGPGARLSLARMPLPLPARVDFSLAGALNT
GFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAEL
RELRLRLDQLTAGSARLEVERDNLAQDLGTLKQKLQDETNLRLEAENNLATYRQEADEAT
LARLDLERKIESLEEEIRFLRKIHEEEVQELQEQLARQQVHVELDVAKPDLTAALREIRT
QYEAMASSNMHEAEEWYRSKFADLNDAAARNAELLRQAKHEANDYRRQLQTLTCDLESLR
GTNESLERQMREQEERHAREAASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALD
IEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEV
IKESKQEHKDVM
NT seq 1299 nt   +upstreamnt  +downstreamnt
atggagaggagacgggtcacttcagctgctcgccgctcctatgtctcctcctcggacgtg
gtggggggaagcctggtctccggccgccggctggggccgggcgcccgcctctccctggcc
aggatgccgcttccactgccggcccgggtggacttctccctggccggggcactcaacacc
ggcttcaaggagacccgggccagtgagcgggcagagatgatggagctcaacgaccgcttt
gccagctacattgagaaggtgcgcttcctggaacagcagaacaaggcgctggccgcggag
ctgaaccagctgcgggccaaggagcccaccaagctggccgatgtctaccaggctgagctg
cgtgagctaaggctgcggctcgaccagctcactgccggcagcgcccggctcgaggtcgag
agagacaatctggcacaggacctgggcaccctgaagcagaagctccaggatgaaaccaac
ctgaggctggaggctgagaacaacctggccacctatcgacaggaggcagatgaagccacc
ttagcccgtctggatctggagaggaagattgagtctctcgaggaggaaatccggtttttg
aggaagatccatgaggaggaggtgcaggagctccaggagcagctggcccggcagcaggtc
catgtggagctggatgtggccaagcccgacctcacggcggccttgagagagatccgcacg
cagtacgaggccatggcatccagcaacatgcatgaggccgaggagtggtaccggtccaag
tttgccgacctgaacgatgccgctgcccgcaacgccgagctgctccgccaggccaagcac
gaggccaacgactaccggcgccagctgcagaccttgacctgcgacctggagtccttgcgc
ggcacgaacgagtccctggagaggcagatgcgggagcaggaggagcgccacgcgcgggag
gcggcgagttaccaggaggcgctggcccggctggaggaggaggggcagagcctcaaagac
gagatggcccgccatctgcaggagtaccaggacttgttgaacgtcaagctggccctggac
atcgagatcgccacctacaggaagctgctggagggcgaggagaaccgcatcaccattccc
gtgcagaccttctccaacctgcagatccgagaaaccagcctggacaccaagtccgtgtca
gaaggccacctcaagaggaacatcgtggtaaaaaccgtggagatgcgggacggagaggtc
attaaggagtccaaacaggagcacaaggacgtgatgtga

DBGET integrated database retrieval system