KEGG   Ursus arctos horribilis: 113265359
Entry
113265359         CDS       T05909                                 

Definition
(RefSeq) uncharacterized protein LOC113265359
  KO
K10785  T-cell receptor beta chain V region
Organism
uah  Ursus arctos horribilis
Pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04020  Calcium signaling pathway
uah04064  NF-kappa B signaling pathway
uah04514  Cell adhesion molecules (CAMs)
uah04612  Antigen processing and presentation
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah04672  Intestinal immune network for IgA production
uah04940  Type I diabetes mellitus
uah05135  Yersinia infection
uah05142  Chagas disease (American trypanosomiasis)
uah05144  Malaria
uah05150  Staphylococcus aureus infection
uah05162  Measles
uah05166  Human T-cell leukemia virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05202  Transcriptional misregulation in cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05310  Asthma
uah05320  Autoimmune thyroid disease
uah05321  Inflammatory bowel disease (IBD)
uah05322  Systemic lupus erythematosus
uah05323  Rheumatoid arthritis
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
uah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113265359
   04015 Rap1 signaling pathway
    113265359
   04064 NF-kappa B signaling pathway
    113265359
   04020 Calcium signaling pathway
    113265359
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    113265359
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    113265359
   04660 T cell receptor signaling pathway
    113265359
   04658 Th1 and Th2 cell differentiation
    113265359
   04659 Th17 cell differentiation
    113265359
   04672 Intestinal immune network for IgA production
    113265359
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    113265359
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113265359
  09163 Immune disease
   05310 Asthma
    113265359
   05322 Systemic lupus erythematosus
    113265359
   05323 Rheumatoid arthritis
    113265359
   05320 Autoimmune thyroid disease
    113265359
   05321 Inflammatory bowel disease (IBD)
    113265359
   05330 Allograft rejection
    113265359
   05332 Graft-versus-host disease
    113265359
  09166 Cardiovascular disease
   05416 Viral myocarditis
    113265359
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113265359
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    113265359
   05150 Staphylococcus aureus infection
    113265359
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113265359
   05170 Human immunodeficiency virus 1 infection
    113265359
   05162 Measles
    113265359
   05169 Epstein-Barr virus infection
    113265359
  09174 Infectious disease: parasitic
   05144 Malaria
    113265359
   05142 Chagas disease (American trypanosomiasis)
    113265359
SSDB
Motif
Pfam: V-set
Other DBs
NCBI-GeneID: 113265359
NCBI-ProteinID: XP_026368472
UniProt: A0A3Q7WTW4
LinkDB
Position
Unknown
AA seq 259 aa
MGGEKASEKAARLCSFPKAVMCPVFICSLVLWFLSAGTLNAEVTQTPGHLVTGKGQKAEM
HCVPIKGHSYVFWYQQIPAKELKFLISFQNGVIFDKTGMPEKRFSAVCPQNSPCSLEIKP
TELQDLAVYFCASSESTVDTQTLQSARSPATGSPKMGQRRVLRCDPISGHRLAYWCPQNQ
RQGMEFLISFQNENTAAELGCPRNSSQPKDLMEHLPPEDPSHRAGGLSCDLRAGCLGTVQ
LSSSLQCANSPAPLLSPEL
NT seq 780 nt   +upstreamnt  +downstreamnt
atgggcggtgaaaaagcctcagagaaagctgcccgcctctgttctttccctaaagccgtc
atgtgccccgtcttcatctgctccttggtcctttggttcctgagtgcaggcaccctcaat
gcagaagtcacccagactccaggacacctggtcacagggaaaggacagaaggcagaaatg
cactgtgtcccaataaaaggacacagttatgttttctggtatcagcagatcccagcaaaa
gagctcaagttcttgatttctttccagaatggcgtcatctttgacaaaacaggaatgccc
gagaagagattttcagctgtgtgtccccaaaactcaccctgtagcctagagatcaagcct
acggagctgcaggatttagccgtgtatttctgtgccagcagtgaatccacagtggacaca
cagactctgcagtcagccagatccccagccacaggatcaccaaagatgggacagaggagg
gttctgagatgcgacccaatttccggtcacagattggcttactggtgcccacagaatcag
aggcagggaatggagtttctgatttccttccaaaatgaaaacactgcagctgagctggga
tgcccaaggaacagctctcagccgaaggacctaatggaacatcttccacccgaagaccca
tcccacagagctgggggactcagctgtgatctgcgtgctggctgccttggcacggtgcag
ttgagcagttccctccagtgcgcaaactcaccggctcctctcctctcccctgagctctag

DBGET integrated database retrieval system