KEGG   Ursus arctos horribilis: 113265423
Entry
113265423         CDS       T05909                                 

Gene name
STAT5A
Definition
(RefSeq) signal transducer and activator of transcription 5A isoform X1
  KO
K11223  signal transducer and activator of transcription 5A
Organism
uah  Ursus arctos horribilis
Pathway
uah04012  ErbB signaling pathway
uah04217  Necroptosis
uah04630  Jak-STAT signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04917  Prolactin signaling pathway
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah04935  Growth hormone synthesis, secretion and action
uah05161  Hepatitis B
uah05162  Measles
uah05166  Human T-cell leukemia virus 1 infection
uah05200  Pathways in cancer
uah05203  Viral carcinogenesis
uah05220  Chronic myeloid leukemia
uah05221  Acute myeloid leukemia
uah05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    113265423 (STAT5A)
   04630 Jak-STAT signaling pathway
    113265423 (STAT5A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113265423 (STAT5A)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    113265423 (STAT5A)
   04659 Th17 cell differentiation
    113265423 (STAT5A)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    113265423 (STAT5A)
   04935 Growth hormone synthesis, secretion and action
    113265423 (STAT5A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113265423 (STAT5A)
   05203 Viral carcinogenesis
    113265423 (STAT5A)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    113265423 (STAT5A)
   05220 Chronic myeloid leukemia
    113265423 (STAT5A)
   05223 Non-small cell lung cancer
    113265423 (STAT5A)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113265423 (STAT5A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113265423 (STAT5A)
   05162 Measles
    113265423 (STAT5A)
   05161 Hepatitis B
    113265423 (STAT5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:uah03000]
    113265423 (STAT5A)
Transcription factors [BR:uah03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    113265423 (STAT5A)
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 113265423
NCBI-ProteinID: XP_026368593
UniProt: A0A3Q7X2U7
LinkDB
Position
Unknown
AA seq 794 aa
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGTSPVGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RVQAQFAGLAQLNPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
STSHLEDYNGMSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKPFTTRDFSIRSLADRL
GDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVSASADSAGASATY
MDQAPSPAVCPQAHYNMYPQNPDPVLDQDGEFDLDETMDVARHVEELLRRPMDSLDPRLS
PPAGLFTAARGSLS
NT seq 2385 nt   +upstreamnt  +downstreamnt
atggcgggctggatccaagcccagcagctgcagggagatgcgctgcgccagatgcaggtg
ctgtatgggcagcacttccccatcgaggttcggcactacttggcgcagtggatcgagagc
cagccgtgggatgccattgacctggacaatccccaggaccgagcccaggccacccagctc
ctggagggcctggtgcaggagctgcagaagaaggcagagcaccaagtcggggaagatggg
ttcttgctgaagatcaagctggggcactatgccacgcagctccagaacacgtacgaccgc
tgccccatggagctggtccgctgcatccgacacattctgtacaatgaacagaggctggtg
cgagaagccaacaacggtacttctccagttggaagtcttgctgacgccatgtcccagaag
cacctccagatcaaccagacgtttgaggagctgcgactggtcacacaggacacggagaat
gaactgaagaagctgcagcagactcaggagtacttcatcatccagtaccaggagagcctg
agggtccaggctcagttcgccgggctggcccagctgaatcctcaggagcgtctgagccgg
gagacggccctccagcagaagcaggtgtccctggaggcctggctgcagcgtgaggcccag
acgctgcagcagtaccgtgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcagcagaccatcattctggacgacgagctgatccagtggaagcggcggcagcag
ctggcagggaacggagggccccccgagggcagcctggacgtgctgcagtcctggtgtgag
aagttggccgagatcatctggcagaaccggcagcagatccgcagagcagagcacctgtgc
cagcagctgcccatccccggtccagtggaggagatgctggctgaggtcaatgccaccatc
acagacatcatctcagccctggtgaccagcacattcatcattgagaagcagccccctcag
gtcctgaagacccagaccaagtttgcagcgacggtgcgcctgctggtgggcgggaagcta
aatgtgcacatgaaccccccccaggtgaaggccaccatcatcagcgagcagcaggccaag
tcgctgctcaagaacgagaacacccgcaacgagtgcagcggcgagatcttgaacaactgc
tgtgtgatggagtaccaccaggccaccggcaccctcagcgcgcacttccggaacatgtcc
ctgaagaggattaagcgtgctgaccgcaggggcgcggagtccgtgacggaagagaagttc
acggtcctgtttgagtctcagttcagtgttggcagcaatgagctggtgttccaggtgaag
actctgtcccttcccgtggttgtcatcgttcatggcagccaggaccacaacgcgaccgcc
accgtgctgtgggacaacgcctttgccgagccgggtagggtgccattcgccgtgcccgac
aaagtgctgtggccacagctgtgtgaggcgctcaacatgaaattcaaggccgaagtgcag
agcaaccggggcctgaccaaggagaacctcgtgttcctggcccagaaactgttcaacagc
agcaccagccacctcgaagactataatggcatgtccgtgtcctggtcccagttcaacagg
gagaacttgccgggctggaactacaccttctggcagtggttcgatggggtcatggaggtg
ctgaagaagcatcacaagccccattggaatgacggggccatcctaggttttgtgaataag
caacaggcccacgacctgctcatcaacaagcccgatgggacctttttattgcgctttagc
gactccgaaatcgggggcatcaccattgcctggaagtttgactctcctgaccgcaacctg
tggaacctgaagccgttcaccacacgggacttctccattcggtcgctggctgaccggctg
ggggacctgagctatctcatctacgtgtttcccgaccggcccaaggatgaggtcttctcc
aagtactacacccctgtgcttgctaaagcggtggacggatacgtgaagccacagatcaag
caagtggtccctgagtttgtgagtgcgtctgcggactctgccggggccagcgccacctac
atggaccaggccccctccccggccgtgtgcccccaggctcattataacatgtacccccag
aaccctgaccccgtcctcgaccaggatggagaatttgacctggatgagaccatggatgta
gcccggcacgtggaggaactcttacgccgcccgatggatagtctggacccccgtctctcc
ccacccgctggtcttttcactgccgcccgaggctcgctctcatga

KEGG   Ursus arctos horribilis: 113265424
Entry
113265424         CDS       T05909                                 

Definition
(RefSeq) signal transducer and activator of transcription 5B isoform X1
  KO
K11224  signal transducer and activator of transcription 5B
Organism
uah  Ursus arctos horribilis
Pathway
uah04012  ErbB signaling pathway
uah04062  Chemokine signaling pathway
uah04217  Necroptosis
uah04630  Jak-STAT signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04917  Prolactin signaling pathway
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah04935  Growth hormone synthesis, secretion and action
uah05161  Hepatitis B
uah05162  Measles
uah05166  Human T-cell leukemia virus 1 infection
uah05200  Pathways in cancer
uah05203  Viral carcinogenesis
uah05220  Chronic myeloid leukemia
uah05221  Acute myeloid leukemia
uah05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    113265424
   04630 Jak-STAT signaling pathway
    113265424
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113265424
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    113265424
   04659 Th17 cell differentiation
    113265424
   04062 Chemokine signaling pathway
    113265424
  09152 Endocrine system
   04917 Prolactin signaling pathway
    113265424
   04935 Growth hormone synthesis, secretion and action
    113265424
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113265424
   05203 Viral carcinogenesis
    113265424
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    113265424
   05220 Chronic myeloid leukemia
    113265424
   05223 Non-small cell lung cancer
    113265424
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113265424
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113265424
   05162 Measles
    113265424
   05161 Hepatitis B
    113265424
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:uah03000]
    113265424
Transcription factors [BR:uah03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    113265424
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 113265424
NCBI-ProteinID: XP_026368595
UniProt: A0A3Q7WU54
LinkDB
Position
Unknown
AA seq 787 aa
MAVWIQAQQLQGDALHQMQALYGQHFPIEVRHYLSQWIESQAWDSIDLDNPQENIKATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGTSPVGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RVQAQFAGLAQLNPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
STSHLEDYNGMSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL
GDLNYLIYVFPDRPKDEVYSKYYTPVPCEPAAAKAVDGYVKPQIKQVVPEFVSASADSAG
ASATYMDQAPSPAVCPQAHYNMYPQNPDPVLDNDGDFDLDDTMDVARRVEELLGRPMDSQ
WIPHAQS
NT seq 2364 nt   +upstreamnt  +downstreamnt
atggctgtgtggatacaagcccagcagctccaaggcgatgcacttcatcagatgcaagca
ttatatggtcagcatttccccattgaggtgcgacattatttatcccaatggattgaaagc
caagcgtgggactcaatagatcttgataatccacaggagaacattaaggccacccagctc
ctggagggcctggtgcaggagctgcagaagaaggcagagcaccaagtcggggaagatggg
ttcttgctgaagatcaagctggggcactatgccacgcagctccagaacacgtacgaccgc
tgccccatggagctggtccgctgcatccgacacattctgtacaatgaacagaggctggtg
cgagaagccaacaatggtacttctccagttggaagtcttgctgacgccatgtcccagaag
cacctccagatcaaccagacgtttgaggagctgcgactggtcacacaggacacggagaat
gaactgaagaagctgcagcagactcaggagtacttcatcatccagtaccaggagagcctg
agggtccaggctcagttcgccgggctggcccagctgaatcctcaggagcgtctgagccgg
gagacggccctccagcagaagcaggtgtccctggaggcctggctgcagcgtgaggcccag
acgctgcagcagtaccgtgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcagcagaccatcattctggacgacgagctgatccagtggaagcggcggcagcag
ctggcagggaacggagggccccccgagggcagcctggacgtgctgcagtcctggtgtgag
aagttggccgagatcatctggcaaaaccggcagcagatccgcagagcagagcacctgtgc
cagcagctgcccatccccggtccagtggaggagatgctggctgaggtcaatgccaccatc
acagacatcatctcagccctggtgaccagcacattcatcattgagaagcagccccctcag
gtcctgaagacccagaccaagtttgcagcgacggtgcgcctgctggtgggcgggaagcta
aatgtgcacatgaaccccccccaggtgaaggccaccatcatcagcgagcagcaggccaaa
tcgctgctcaagaacgagaacacccgcaatgactacagcggcgagatcttgaacaactgc
tgtgtgatggagtaccaccaggccaccggcaccctcagcgcgcacttccggaacatgtcc
ctgaaacgaattaagagatctgaccgtcgtggagcagagtcagtgacagaagaaaaattc
acaatcctgtttgaatcacagttcagtgttggtggaaatgagctggtttttcaagtcaag
accctgtccctcccagtggtggtgatcgtccatggtagccaggacaacaacgcaacggcc
accgttctctgggacaatgcttttgcagagcctggcagggtgccattcgccgtgcccgac
aaagtgctgtggccgcagctgtgtgaggcgctcaacatgaaattcaaggccgaagtgcag
agcaaccggggcctgaccaaggagaacctcgtgttcctggcccagaaactgttcaacagc
agcaccagccacctcgaagactataatggcatgtccgtgtcctggtcccagttcaacagg
gagaatttaccaggacgaaattacacgttctggcagtggttcgatggtgtgatggaagtg
ttaaaaaaacatctcaagcctcattggaatgatggggctattttgggttttgtgaacaag
caacaggcccatgacctactcattaacaagcctgatgggaccttcctgttgagattcagc
gactctgaaattgggggcatcaccattgcttggaagtttgattctcaggaaagaatgttt
tggaacctgatgccctttaccaccagagacttctccatccggtccctggctgaccgcttg
ggggacctgaattaccttatctacgtgtttcctgatcggccaaaagatgaagtgtactcc
aagtattacacgccagttccatgcgagcctgctgccgctaaagcggtggacggatacgtg
aagccacagatcaagcaagtggtccctgagtttgtgagtgcgtctgcggactctgccggg
gccagcgccacctacatggaccaggccccctccccggccgtgtgcccccaggctcattat
aacatgtacccccagaaccctgaccctgtccttgacaacgatggggactttgatctggac
gacacaatggatgtggcccggcgtgtggaggagctcctaggccgccctatggacagtcag
tggatccctcacgcgcagtcgtga

DBGET integrated database retrieval system