KEGG   Ursus arctos horribilis: 113265679
Entry
113265679         CDS       T05909                                 

Gene name
CCR10
Definition
(RefSeq) C-C chemokine receptor type 10
  KO
K04185  C-C chemokine receptor type 10
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04062  Chemokine signaling pathway
uah04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113265679 (CCR10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113265679 (CCR10)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    113265679 (CCR10)
   04062 Chemokine signaling pathway
    113265679 (CCR10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:uah04030]
    113265679 (CCR10)
   04050 Cytokine receptors [BR:uah04050]
    113265679 (CCR10)
G protein-coupled receptors [BR:uah04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    113265679 (CCR10)
Cytokine receptors [BR:uah04050]
 Chemokine receptors
  CC Chemokine
   113265679 (CCR10)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 113265679
NCBI-ProteinID: XP_026369014
UniProt: A0A3Q7XQD9
LinkDB
Position
Unknown
AA seq 358 aa
PPQISRGAYSGEDEEAYSVEPLPELCYKADVQAFSRAFQPSVSLVVAALGLAGNGLVLAT
HLAARRAVRSPTSAHLLQLALADLLLALTLPFAAAGALQGWSLGSATCRAISGLYSASFH
AGFLFLACISADRYVAITRALPAAPRPSAPGRAHMVSAIVWLLSLLLALPALLFSQDGPR
EGQRRCRLVFPEGLTQTVKGASAVAQVALGFALPLGVMAACYALLGRTLLAARGPERRRA
LRVVVALVAAFVVLQLPYSLALLLDTADLLAARERSCPASKRKDLALLVTGGLALARCGL
NPVLYAFLGLRFRQDLRRLLRGGSCSPGPHPRGRCPRRPRLSSCSAPTETHSVSSWDY
NT seq 1077 nt   +upstreamnt  +downstreamnt
cctccccagatctctaggggcgcctactctggggaggatgaggaggcatactcggtggag
ccgttgccagagctctgctacaaggcggatgtccaggccttcagtagggccttccaaccc
agtgtctccctggtagtggctgcactgggtctggctggcaatggcctggtcctggccacc
cacctggcagcccgacgtgctgtccgttcgcccacttctgcccacctgctccagctggcc
ctggccgaccttctactggccctaaccctgccctttgccgcagccggggctctgcagggc
tggagtctgggaagtgccacctgccgcgccatctcaggcctctactcagcctccttccac
gccggcttcctcttcctggcctgtatcagcgccgaccgctacgtggccatcacgcgggcc
ctccccgcggcaccgaggccctctgctcccggccgcgcgcacatggtctcggccatcgtg
tggctgctgtcgctgcttctggcgctgcctgctctccttttcagccaggacgggccgcgg
gaaggccagcggcgctgccgtctcgtcttccccgagggcctcacgcagacggtgaagggg
gcaagcgccgtggcgcaggtggccctgggcttcgcgctgccgctgggcgtcatggccgcc
tgctacgcgctcctgggccgcacgctgctggccgccagggggcccgagcgccggcgtgcg
ctgcgcgtcgttgtggccctggtggcggccttcgtggtgctgcagctgccctacagtctc
gccctgctactggatacggcggacctactggctgcccgcgagcggagctgccctgccagc
aagcgcaaggatctggcactgctggtgaccggagggttggccctggcccgctgcggcctc
aaccccgtgctctacgcctttttgggcctgcgcttccgccaggacctgcggaggctgctg
cggggtgggagctgcagcccagggcctcacccccgcggccgctgcccccgccggccccgc
ctctcttcctgttcggctcccactgagacccacagtgtctcctcctgggactactag

DBGET integrated database retrieval system