KEGG   Ursus arctos horribilis: 113265870
Entry
113265870         CDS       T05909                                 

Definition
(RefSeq) whey acidic protein-like
  KO
K17106  whey acidic protein
Organism
uah  Ursus arctos horribilis
Pathway
uah04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    113265870
SSDB
Motif
Pfam: WAP
Other DBs
NCBI-GeneID: 113265870
NCBI-ProteinID: XP_026369093
UniProt: A0A3Q7X471
LinkDB
Position
Unknown
AA seq 152 aa
MRCLASLTLALLALEAALALAPAPALTLPGQAMCPELSSSEEDACTVSCNSDESCPRGTK
CCPRSPCSRSCMVPFIAPAQKAGRCPHVQAPLISAPCLESNECSRDDQCADNRKCCLSAC
AMRCLEPEAGERPTPSPDSAPASATDAAEGLG
NT seq 459 nt   +upstreamnt  +downstreamnt
atgcgctgtctcgccagcctaactctggccctgctggccctggaggccgccctggccctg
gccccggccccagccctcaccttgccagggcaggccatgtgcccggagctcagctcctcg
gaggaggatgcctgcacggtctcctgcaactcggatgagagctgcccccgaggcaccaaa
tgctgccccaggagcccctgcagccgctcctgcatggtccctttcatcgctcccgcgcag
aaggcaggccgctgcccccacgtgcaggccccgctgatctcagcaccctgtttggagagc
aacgagtgttccagagacgaccagtgcgcggacaacaggaagtgctgcctcagcgcctgt
gccatgcggtgtctggagcccgaggcaggtgagcgccccacaccctccccggacagcgcc
ccggcctcggccaccgatgcagcagaaggtctgggctga

DBGET integrated database retrieval system