KEGG   Ursus arctos horribilis: 113265932
Entry
113265932         CDS       T05909                                 

Gene name
MAGI2
Definition
(RefSeq) membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2
  KO
K05629  atrophin-1 interacting protein 1
Organism
uah  Ursus arctos horribilis
Pathway
uah04015  Rap1 signaling pathway
uah04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    113265932 (MAGI2)
   04151 PI3K-Akt signaling pathway
    113265932 (MAGI2)
SSDB
Motif
Pfam: PDZ PDZ_6 MAGI_u1 PDZ_2 WW Guanylate_kin MAGI_u5
Other DBs
NCBI-GeneID: 113265932
NCBI-ProteinID: XP_026369170
UniProt: A0A3Q7WVW4
LinkDB
Position
Unknown
AA seq 1404 aa
MSKSLKKKSHWTSKVHESVIGRNPEGQLGFELKGGAENGQFPYLGEVKPGKVAYESGSKL
VSEELLLEVNETPVAGLTIRDVLAVIKHCKDPLRLKCVKQGGIVDKDLRHYLNLRFQKGS
VDHELQQIIRDNLYLRTVPCTTRPHKEGEVPGVDYIFITVEDFMELEKSGALLESGTYED
NYYGTPKPPAEPAPLLLNVTDQILPGATPSAEGKRKRNKSVSNMEKASIEPPEEEEEERP
VVNGNGVVVTPESSEHEDKSAGASGETPSQPYPAPVYSQPEELKEQIDDAKPTKPEDNEE
SDPLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPPEECKENELPYGWEKIDDP
IYGTYYVDHINRRTQFENPVLEAKRKLQQHNMPHTELGTKPLQAPAFREKPLFTRDASQL
KGTFLSTTLKKSNMGFGFTIIGGDEPDEFLQVKSVIPDGPAAQDGKMETGDVIVYINEVC
VLGHTHADVVKLFQSVPIGQSVNLVLCRGYPLPFDPEDPANSMVPPLAIMERPPPVMVNG
RHNYETYLEYISRTSQSVPDITDRPPHSLHSMPADGQLDGTYPPPVHDDNVSMASSGATQ
AELMTLTIVKGAQGFGFTIADSPTGQRVKQILDIQGCPGLCEGDLIVEINQQNVQNLSHT
EVVDILKDCPIGSETSLIIHRGGFFSPWKTPKPIMDRWENQGSPQTSLSAPAIPQNLPGP
PALHRTSFPDSTEAFDPRKPDPYELYEKSRAIYESRQQVPPRTSFRMDSSGPDYKELDVH
LRRMESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRY
VIDLMHHAARNGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYTNSNHAA
PSSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGSTITVPHKIGRIIDG
SPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIKDAGLSVTLRIIPQEELNSPASAPS
SEKQSPMAQQSPLAQPTPATPNSPVAQPAPPQPLQLQGHENSYRSEVKARQDVKPDIRQP
PFTDYRQPPLDYRQPPGGDYQQPPPLDYRQPPLLDYRQHSPDTRQYPLAEYRQPQDFDYF
TVDMEKGAKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGESTRDMT
HARAIELIKSGGRRVRLLLKRGTGQVPEYDEPNSWSSPAAASPGLPEVGVSLEDVLSPFS
PSHPAPPSDPSHQIGPDPTWDIKREHDVRKPKELSAGGQKKQRLGEQRERSASPQRAARP
RLEEAPGGQGRPEAGRSSSEARAPGPAAADAADAVRAGAGLRQGARPPGGAPTRKAAVAP
GPWKVPGSDKLPGVLKPGASAAGR
NT seq 4215 nt   +upstreamnt  +downstreamnt
atgtccaaaagcttgaaaaagaaaagccactggactagcaaagtccatgagagtgtcatt
ggcaggaacccggagggccagctgggctttgaactgaaggggggcgccgagaacggacag
ttcccctacctgggggaggtgaagcccggcaaggtggcctatgagagcggcagcaagttg
gtgtcggaggagctgctgctggaagtgaacgagactcccgtggcggggctcaccatcagg
gacgtgctggccgtgatcaaacactgcaaggaccccctccgactcaagtgtgtcaaacaa
ggaggaattgttgataaggatcttcgtcactacctcaacttacgatttcagaagggttct
gtggaccacgaacttcaacaaatcatccgtgacaacctctacctccgcacggtgccatgc
accacaaggccacataaggagggtgaggtccctggagtggactatattttcatcaccgtt
gaagattttatggaattggagaaaagtggtgctctcctagaaagtgggacttatgaagac
aattactacggcacgccaaagcctccagcagaaccagcaccattattgttaaatgtgaca
gaccagatacttccgggagccactccaagtgctgaaggaaaacggaagaggaataaatca
gtgagcaacatggagaaagcaagtatagagcctcctgaggaggaagaggaagagaggcct
gtggtcaatggaaatggagtagtagtaacaccagaatccagtgaacatgaagacaagagt
gcaggtgcctcaggggagacaccctcccagccttatcctgcaccagtgtacagtcagccc
gaggagctgaaggagcagatagatgatgcaaaaccaactaaacctgaagacaatgaggag
tcagacccattgcctgataattgggaaatggcctatacagagaagggtgaagtctacttc
attgaccataacacaaagacaacatcatggctggatccacgacttgcgaaaaaggctaaa
ccgccagaagagtgcaaagagaatgagcttccatatggctgggaaaaaatcgatgatccc
atatatggcacttattatgttgaccacataaatagaagaacacagtttgaaaaccccgtc
ctggaagcaaaaagaaagctacagcagcataacatgccccacacagaacttggaacaaag
cccctgcaggcgccagctttccgagaaaaaccgctcttcacccgggatgcatcccagttg
aagggaacattcctcagcaccaccctaaaaaagagcaacatgggttttggattcaccatc
attggtggagatgagcctgacgagtttctgcaggtgaaaagtgtgattccggatgggcct
gcagcgcaggatgggaaaatggaaacaggtgatgtcattgtctatattaatgaagtgtgt
gtccttggacacactcatgcagatgtagtcaaacttttccagtctgttcctattggtcag
agtgtcaacctggtgttgtgtcgtggctaccctttgccctttgatcctgaagatcctgct
aacagcatggtgccaccccttgcaataatggagaggccacctccagtgatggtcaatgga
agacataactatgaaacatatttggaatacatttctcggacctcacagtcggttccagat
ataacagatcggccgcctcattctttgcactcaatgccagctgatggtcaactagatggc
acgtatccaccacccgtccatgacgacaatgtgtctatggcttcatctggggccacccaa
gctgaacttatgaccttaaccattgtgaaaggtgcccagggctttggcttcactatcgct
gacagtcctacaggacagcgggtgaaacaaatacttgacattcagggatgccctggcctg
tgtgaaggcgacctcattgtggagatcaaccagcagaatgtacagaacctgagccataca
gaagtagtggatatacttaaggactgtcccattggaagcgagacttctttgattatccat
cgaggaggtttcttttctccatggaaaactccaaagcctataatggaccgctgggagaat
caaggcagtcctcaaacgagtttatctgctccggccataccgcagaacctgccgggtcca
cccgctcttcacaggacttcctttcctgactcaacagaggcctttgacccaaggaagcct
gacccatacgagctctacgagaaatctagagcgatttatgaaagtaggcaacaagtgcca
ccaaggaccagttttcgaatggattcctctggtccagattataaggagctggatgtccac
cttcgaaggatggagtctggatttggcttcagaatcctcgggggagatgagcctgggcag
cctattttgattggcgccgtcattgccatgggttcagccgacagagacggccgcctgcac
cccggagacgagcttgtctatgtcgacgggattccagtggctggcaagacccaccgctat
gtcatcgacctgatgcaccatgcagcccgaaatgggcaggtcaacctcactgtgagaagg
aaggtgctctgtggaggggagccctgcccagagaacgggaggagtccaggctccgtgtca
acccaccacagctctccacgcagtgactacgccacctacaccaacagcaaccacgctgcc
cccagtagcaatgcctctccacctgaaggcttcgcctcccacagcctgcagaccagcgat
gtggtcattcaccgcaaagagaacgaaggcttcggctttgtcatcatcagctccctgaac
agacctgagtccggatccactatcactgtgccccataaaatcggacgcatcatcgatggg
agtcctgcagatcgctgtgcaaaactgaaagtgggagaccggatcttggcagtgaacggc
cagtccatcatcaacatgcctcatgcagacatcgtgaagctcatcaaggacgcgggtctc
agtgtcaccctccgcatcattcctcaggaggagctcaacagcccagcctcggcgcctagc
tcagagaagcagagcccgatggcccagcagagtcctctggcccagccgaccccagccacc
cccaacagtcctgttgcccagccagctcctcctcaaccacttcagctgcaaggacatgaa
aatagttacaggtcagaagtaaaagcgaggcaagatgtgaaaccagacatccgacagcct
ccattcacggactacaggcagccgccgctggactacaggcagcccccgggaggggactac
cagcaacccccacccttggactataggcagcctcccctgctggactacaggcagcactcc
cctgacaccaggcagtaccctctggcggagtataggcagccccaggattttgattatttc
actgtggacatggagaaaggagccaaaggatttggattcagcattcgtggaggaagggaa
tacaaaatggatttgtacgtgttgagattggcagaagatgggcccgcgataaggaatgga
aggatgagggtaggagatcaaatcatcgaaatcaatggggagagcacaagggacatgaca
cacgccagagcaatagaactcatcaagtcaggaggaagaagggtccgtctcctactgaag
cgtgggacggggcaggtcccggagtatgacgaacccaactcctggagttctcccgctgcc
gcctccccaggtctgccggaagtaggcgtctccctcgaggacgtcctctctccattctct
ccatcacatccagccccaccctccgacccttcccaccagataggcccagacccaacttgg
gatatcaaaagggaacacgacgttaggaaaccaaaggagctttcagccggcggccagaag
aagcagcgcctcggggagcagagggagcgctcggcgagcccgcagagggccgctcggccg
aggctcgaggaggcacccggcggccaggggcggcccgaggccggcaggtcctcctcggag
gccagggcgcccgggcccgcggcggcggacgcggcggacgcggtgcgggccggcgcgggg
ctccggcagggcgcgcggcccccggggggcgcccccacgcgcaaggccgccgtggcgccc
gggccgtggaaagtgcccggctccgacaagctgccgggcgtcctcaagcccggagcctcg
gctgcgggcagatga

DBGET integrated database retrieval system