KEGG   Ursus arctos horribilis: 113265955
Entry
113265955         CDS       T05909                                 

Gene name
FOXP3
Definition
(RefSeq) forkhead box protein P3 isoform X1
  KO
K10163  forkhead box P3
Organism
uah  Ursus arctos horribilis
Pathway
uah04659  Th17 cell differentiation
uah05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    113265955 (FOXP3)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113265955 (FOXP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:uah03000]
    113265955 (FOXP3)
Transcription factors [BR:uah03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    113265955 (FOXP3)
SSDB
Motif
Pfam: FOXP-CC Forkhead
Other DBs
NCBI-GeneID: 113265955
NCBI-ProteinID: XP_026369215
UniProt: A0A3Q7WW14
LinkDB
Position
Unknown
AA seq 447 aa
MDREGLCLPLNKDPMPNPRPAKPSAPSLALGPSPGASPSWRAAPKASDLLGSKGPGANFQ
SRDLRGGAHASSSSSSLNPMPPSQLQLPTVPLVMVAPSGARLGPSPHLQALLQDRPHFMH
QLSTVDTHARTPVLQVRPLDSPAMISLPPPTAATSVFSLKARPGLPPGINVASLEWVSRE
PALLCTFPSPGTPRKDSTLSTVPQGSYSLLANGVCKWPGCEKVFEEPEDFLKHCQADHLL
DEKGRAQCLLQREVVQSLEQQLVLEKEKLGAMQAHLAGKMALTKAPSTASSDKGSCCIVA
SGTPVATGPGWPSPQEAPDGLFAVRRHLWGSHGNSTFPEFFHNMDYFKSHNMRPPFTYAT
LIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGA
VWTVDEFEFRKKRSQRPSRSANPTPGP
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggaccgcgaagggctgtgcctgcccttgaacaaggacccaatgcccaatcccaggcca
gccaagccctcggccccttccttggcacttggcccatccccgggagcctcacccagctgg
agggctgcacccaaggcttcagacctgcttgggtccaagggcccgggggcaaacttccag
agccgggacctccgaggcggagcccatgcctcctcctcctcctcctctttgaaccccatg
ccaccatcgcagctgcagctgcccacagtgcccctagtcatggtggcaccctctggggca
cggctgggaccctcgccccacttgcaggcactcctccaggacaggccgcacttcatgcac
cagctgtccacggtggatacccacgctcggacccccgtgctgcaggtacgcccactggac
agcccagctatgatcagcctgccgccacccactgctgccaccagcgtcttctccctcaag
gcccggcccggactgccacctgggatcaacgtggccagcctggagtgggtgtccagggag
cccgcgctgctctgcaccttcccaagccccggcacacccaggaaagacagcaccctttcg
accgtgccccagggctcctactcgctgctggcaaatggggtctgcaagtggcccggatgt
gagaaggtcttcgaggagccggaggatttcctcaagcactgccaggcagaccatctccta
gacgagaagggcagggcacagtgtctcctccagagggaggtggtgcagtctctggaacag
cagctagtgctggagaaggagaagctgggcgctatgcaggcccacctggctgggaagatg
gccctgaccaaagctccatccacggcgtcatccgacaagggctcctgctgcatcgttgcc
tcgggcacgcctgtcgccactggcccaggctggcccagcccccaagaagcccccgacggc
ctgtttgctgtgaggaggcatctctggggcagccatggaaacagcacgttcccagagttc
ttccacaacatggactacttcaagtcccacaatatgcggccccccttcacctacgccacc
ctcatccgctgggccatcctggaggctcccgagaagcagcggacactcaacgagatctac
cactggttcacacgcatgttcgccttcttcagaaaccaccccgccacctggaagaacgcc
atccgccacaacctgagcctgcacaagtgcttcgtgcgggtggagagcgagaaaggggcc
gtgtggaccgtggacgaattcgagttccgcaagaagaggagtcagaggcccagcaggagt
gccaaccccacacccgggccctaa

DBGET integrated database retrieval system