KEGG   Ursus arctos horribilis: 113266971Help
Entry
113266971         CDS       T05909                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
uah  Ursus arctos horribilis
Pathway
uah00010  Glycolysis / Gluconeogenesis
uah00053  Ascorbate and aldarate metabolism
uah00071  Fatty acid degradation
uah00280  Valine, leucine and isoleucine degradation
uah00310  Lysine degradation
uah00330  Arginine and proline metabolism
uah00340  Histidine metabolism
uah00380  Tryptophan metabolism
uah00410  beta-Alanine metabolism
uah00561  Glycerolipid metabolism
uah00620  Pyruvate metabolism
uah01100  Metabolic pathways
Module
uah_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:uah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    113266971 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    113266971 (ALDH2)
   00620 Pyruvate metabolism
    113266971 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    113266971 (ALDH2)
   00561 Glycerolipid metabolism
    113266971 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    113266971 (ALDH2)
   00310 Lysine degradation
    113266971 (ALDH2)
   00330 Arginine and proline metabolism
    113266971 (ALDH2)
   00340 Histidine metabolism
    113266971 (ALDH2)
   00380 Tryptophan metabolism
    113266971 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    113266971 (ALDH2)
Enzymes [BR:uah01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     113266971 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh HetR_C
Motif
Other DBs
NCBI-GeneID: 113266971
NCBI-ProteinID: XP_026370677
UniProt: A0A3Q7Y2G8
LinkDB All DBs
Position
Unknown
AA seq 521 aa AA seqDB search
MLRTAALAAAGLGPRLGRRLLSAAATQAVPAPNQQPEVLYNQIFINNEWHDAVSKKTFPT
INPSTGEVICQVAEGDKEDVDRAVKAARAAFQLGSPWRRMDASDRGRLLNRLADLIERDR
TYLAALETLDNGKPYVISYLVDLDMVLKCFRYYAGWADKYHGKTIPIDGDFFSYTRHEPV
GVCGQIIPWNFPLLMQAWKLAPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVN
IIPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGSSNLKRVTLELGGKSPNIIMS
DADMNWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYSEFVERSVARAKSRVVGNPFDSQT
EQGPQVDETQFKKVLGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQDSMTIAREE
IFGPVMQILKFKTIEEVIGRANNSKYGLAAAIFTKDLDKANYLSQALQAGTVWVNCYDVF
GAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcaccgctgcgctcgccgccgctggcctcgggccccgcctgggccgccgtctc
ctgtcggccgctgccacccaggcggtgccggcccccaaccagcagcctgaagtcctctac
aaccagatcttcataaacaatgagtggcacgatgctgtcagcaagaagacattccccacc
atcaatccatccaccggagaagtcatctgtcaggtagctgaaggagacaaggaagacgtg
gacagggcagtaaaggctgcccgggctgccttccagctgggctcaccctggcgccgcatg
gatgcatccgacaggggccgcctgctgaaccgcctggccgatctgattgagcgggaccgg
acctacctagcagccttggagaccctggataacggcaagccctatgtcatctcctacctg
gtggatctggacatggtcctcaaatgcttccgttattatgctggctgggctgataagtac
cacgggaaaaccattcccattgacggggacttcttcagctatacccgccatgaacccgtc
ggggtgtgcgggcagatcattccgtggaacttcccgctcctgatgcaagcctggaaactg
gccccagccctggcgaccggaaacgtggttgtgatgaaggtagctgagcagactccactc
accgccctctatgtggccaacctgattaaggaggctggctttccccctggagtggtcaat
attattcctgggtttggccccacagctggggctgccatcgcctcccatgaggatgtggac
aaagtggccttcacaggctccaccgaggttggccacctaatccaagttgctgcagggagc
agtaacctcaagagagtgaccctggagctgggtggaaagagccccaatatcatcatgtca
gatgcagacatgaactgggctgtggagcaggcccacttcgccctgttcttcaaccagggt
cagtgctgctgtgcgggctcccggacctttgtgcaagaagatgtgtactctgagtttgtg
gagcggagtgttgcccgggccaagtctcgtgtagttgggaacccctttgatagccagact
gagcaggggccgcaggtggacgaaactcagtttaagaaggtccttggttatatcaaatct
gggaaggaggagggggcgaagctgctgtgcggtggaggggcggctgctgaccgtggctac
ttcatccagcccactgtgtttggagatgtgcaagacagcatgactatcgccagggaggag
atctttgggccggtgatgcagattctgaagttcaaaaccatagaggaagtcattgggaga
gccaacaactccaagtatgggctggctgcagctatcttcaccaaggacttggacaaggcc
aattatctgtcccaagccctgcaggctggcactgtgtgggtcaactgctatgatgtgttc
ggggcccagtcaccgttcggtggctacaagatgtctgggagtggccgggagctaggagag
tatgggctgcaggcatacaccgaagtgaaaactgtcacggtcaaagtgcctcagaagaac
tcctga

DBGET integrated database retrieval system