KEGG   Ursus arctos horribilis: 113267098
Entry
113267098         CDS       T05909                                 

Gene name
GIT2
Definition
(RefSeq) ARF GTPase-activating protein GIT2 isoform X1
  KO
K12487  G protein-coupled receptor kinase interactor 2
Organism
uah  Ursus arctos horribilis
Pathway
uah04144  Endocytosis
uah05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113267098 (GIT2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    113267098 (GIT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113267098 (GIT2)
Membrane trafficking [BR:uah04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    113267098 (GIT2)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    113267098 (GIT2)
SSDB
Motif
Pfam: GIT1_C ArfGap GIT_CC GIT_SHD Ank_2 Ank_5 Ank_4 Ank Shugoshin_N TTRAP Sen15 DMPK_coil GAS zf-RRN7 T7SS_ESX_EspC YabA
Other DBs
NCBI-GeneID: 113267098
NCBI-ProteinID: XP_026370877
UniProt: A0A3Q7Y2U5
LinkDB
Position
Unknown
AA seq 759 aa
MSKRLRSSEVCADCSGPDPSWASVNRGTFICDECCSVHRSLGRHISQVRHLKHTPWPPTL
LQMVETLYNNGANSIWEHSLLDPASIMSGRRKANPQDKVHPNKAEFIRAKYQMLAFVHRL
PCRDDDSVTAKDLSKQLHSSVRTGNLETCLRLLSLGAQANFFHPEKGNTPLHVASKAGQI
LQAELLAVYGADPGTQDSSGKTPVDYARQGGHHELAERLVEIQYELTDRLAFYLCGRKPD
HKNGQHFIIPQMADSSLDLSELAKAAKKKLQSLSNHLFEELAMDVYDEVDRRETDAVWLA
TQNHSTLVTETTVVPFLPVNPEYSSTRNQGRQKLARFNAHEFATLVIDILSDAKRRQQGS
PLSGSKDNVELILKTISNQHSVESQDNDQPDYDSVASDEDTDLEATASKANRQKSLDSDL
SDGPVTVQEFMEVKNALVASEAKIQQLMKVNNNLSDELRIMQKKLQTLQSENSNLRKQAT
TNIYQVQTGSEYTDTSNHSSLKRRPSARGSRPMSMYETGSGQKPYLPMGEVNHPEESRTR
LQPFPAHIGRSALVTSSSSLPSFPSTLSWSRDESTRRASRLEKQNSTPESDYDNTPNDTD
PDDTGSSRKGRQRSMVWQGDGSVPDTAEPHTAPSPILPSTEDVIRKTEQITKNIQELLRA
AQENKHDSYIPCSERIHVAVTEMAALFPKKPKSDTVRTSLRLLTSSAYRLQSECKKTLPG
DPGPPTDIQLVTQQVIQCAYDIAKAAKQLVTITTKENNN
NT seq 2280 nt   +upstreamnt  +downstreamnt
atgtcgaagcggcttcggagcagcgaggtgtgcgctgactgcagcggtccggatccttcc
tgggcatcagtaaataggggaacttttatatgtgatgagtgctgcagtgtccatcggagc
ctagggcgccacatctctcaagtaaggcatctgaaacacacaccgtggcctcccacgttg
ctgcagatggttgaaaccttgtataataatggtgctaattctatatgggagcattctttg
ctggaccctgcctctattatgagcggaagacgtaaagctaatccacaggataaagtacat
cctaataaagcagaattcatcagagccaagtatcagatgttagcatttgtccatcgcttg
ccttgccgggatgatgacagcgtgactgccaaagaccttagcaagcaacttcactcaagc
gtgagaacggggaatctcgaaacctgtttgaggctgttatctttaggagcacaagccaac
ttctttcaccctgaaaaaggaaataccccactccatgttgcctccaaagcagggcagatt
ttacaggcagaattattggcggtatatggagcagacccaggcacacaggattctagtgga
aaaactcctgtggattatgcaaggcaaggagggcaccatgagctggcagaacgccttgta
gaaatacagtatgagctgactgacagactagccttctatctctgtggcaggaaaccagat
cacaaaaatggacagcactttataatacctcaaatggcagacagcagcctggatttgtct
gaattggcaaaagctgctaagaagaaacttcaatccctaagtaatcatttgtttgaagaa
cttgccatggatgtgtacgatgaagttgacaggcgagagaccgatgcagtctggcttgcc
acgcaaaaccacagcaccctggtaaccgagacaactgtcgtccccttccttccggtcaat
cctgagtactcttcaacacggaaccagggcagacagaaactcgctaggtttaacgcccat
gagtttgccacactggtcatcgacattctcagcgacgccaagaggagacagcaaggcagt
cctctttctggttcaaaagacaatgtggagctcatattgaaaacaatcagtaaccagcac
agtgttgagagtcaagacaatgaccagccagactatgacagtgtggcctcagacgaagac
acggatctggaagctactgcaagcaaagcaaacaggcagaagagcctagattcagattta
tcagatggaccagtcactgtgcaggaatttatggaggtcaaaaacgctctagtggcttct
gaggccaagatacagcagctaatgaaggtgaataacaacttgagtgacgagctgagaatt
atgcagaaaaagcttcaaacactccagagtgaaaattcgaacctcaggaaacaggccaca
accaatatatatcaggtgcaaactggttctgagtacacagacacttccaaccactcttcc
ttaaagcgacgtccgtctgcccggggcagtaggcccatgtccatgtacgagacgggatca
ggtcaaaaaccatatctcccaatgggagaagtgaaccaccccgaagagagcaggacgaga
ctccagcctttccccgcgcacatcgggaggagtgcgcttgtgacctcctcttcatctctg
ccttccttcccctccacactttcctggtcgagggacgaaagcacccgaagggcatccagg
ctggagaagcagaacagcacacctgaaagtgactacgacaacacccccaatgacacggac
ccagatgatacggggtcaagcagaaagggaaggcagaggagtatggtatggcaaggtgac
ggctcagtaccagataccgcggaaccccacacagccccaagccccatcctccccagcacg
gaagacgtcatccggaagactgaacagatcaccaaaaacatacaggagctcttaagagca
gctcaagaaaataaacatgacagctatatcccctgctcagagaggatacacgtagctgtt
actgaaatggcagcattattccccaaaaaacccaagtctgacacggtgaggacttccctg
cgcttgctgacgtccagtgcctaccgactccagtcagagtgcaagaagaccctccccggg
gaccctggcccgcccacggacatccagctggtcacacagcaggtcatccagtgcgcatat
gacatcgccaaggccgccaagcagctggtcaccatcaccaccaaagagaacaacaactga

DBGET integrated database retrieval system