KEGG   Ursus arctos horribilis: 113267145
Entry
113267145         CDS       T05909                                 

Definition
(RefSeq) uncharacterized protein LOC113267145
  KO
K06856  immunoglobulin heavy chain
Organism
uah  Ursus arctos horribilis
Pathway
uah04020  Calcium signaling pathway
uah04064  NF-kappa B signaling pathway
uah04072  Phospholipase D signaling pathway
uah04145  Phagosome
uah04151  PI3K-Akt signaling pathway
uah04640  Hematopoietic cell lineage
uah04650  Natural killer cell mediated cytotoxicity
uah04662  B cell receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04666  Fc gamma R-mediated phagocytosis
uah04672  Intestinal immune network for IgA production
uah05135  Yersinia infection
uah05140  Leishmaniasis
uah05143  African trypanosomiasis
uah05146  Amoebiasis
uah05150  Staphylococcus aureus infection
uah05152  Tuberculosis
uah05169  Epstein-Barr virus infection
uah05202  Transcriptional misregulation in cancer
uah05310  Asthma
uah05320  Autoimmune thyroid disease
uah05322  Systemic lupus erythematosus
uah05323  Rheumatoid arthritis
uah05330  Allograft rejection
uah05340  Primary immunodeficiency
uah05414  Dilated cardiomyopathy (DCM)
uah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    113267145
   04020 Calcium signaling pathway
    113267145
   04072 Phospholipase D signaling pathway
    113267145
   04151 PI3K-Akt signaling pathway
    113267145
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    113267145
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113267145
   04650 Natural killer cell mediated cytotoxicity
    113267145
   04662 B cell receptor signaling pathway
    113267145
   04664 Fc epsilon RI signaling pathway
    113267145
   04666 Fc gamma R-mediated phagocytosis
    113267145
   04672 Intestinal immune network for IgA production
    113267145
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    113267145
  09163 Immune disease
   05310 Asthma
    113267145
   05322 Systemic lupus erythematosus
    113267145
   05323 Rheumatoid arthritis
    113267145
   05320 Autoimmune thyroid disease
    113267145
   05330 Allograft rejection
    113267145
   05340 Primary immunodeficiency
    113267145
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    113267145
   05416 Viral myocarditis
    113267145
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    113267145
   05150 Staphylococcus aureus infection
    113267145
   05152 Tuberculosis
    113267145
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    113267145
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    113267145
   05140 Leishmaniasis
    113267145
   05143 African trypanosomiasis
    113267145
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113267145
Membrane trafficking [BR:uah04131]
 Endocytosis
  Phagocytosis
   Opsonins
    113267145
SSDB
Motif
Pfam: C1-set ig Ig_3 C2-set_2
Other DBs
NCBI-GeneID: 113267145
NCBI-ProteinID: XP_026370898
UniProt: A0A3Q7X964
LinkDB
Position
Unknown
AA seq 765 aa
MTSYLSPNDTSSALCSRLRVPMTHGSVWAEEQPPESTGKKHAWQRPPFTLKLVATPLVVS
FLGADHRLPGVLEEVKDQMGTDTSWTHAAPGRAPRHRYCPPPTPAAGELAEEGEPLVTAR
LERFLTLTSSPVAIRSTEACWLARGSLWPQPAYSSKYPRAGRGAAETTQPACGLQEAVVS
ILTPILWGGRPVDVQHWATRQREAGLASQSSSCRLSQCVGGPRAPGSCVGVACARGLPRG
ACPGGRARTLRTTFRNSTAGLRHLVLTPAWHVSCVTLGHSLAISVQVSSSAQKKPAPCQA
CEAASGVRAALGPRPHRASCVAEPKTSPSVFPLGLCSAAAAEYVVIACLVQGFFPPEPVS
VTWSPSNENATVRNFPPVKAEAGASYTMSSQLTLPANQCPDDSVLKCQVQHSSNTLPPVS
VPCKAPDPCPVVPPCKCPSCDQPRLSLRQPALEDLLLGSNASLTCTLSGLKDPTGASFTW
KPSGGKDAIQRSPEQDSCGCYSVTSVLPGCAEQWNRGDTFSCAATHPESKSSLTATIKKP
TGNTFRPQVHLLPPPSEELALNELVSLTCLVRGFSPEDVLIRWLQGTQELPPEKYVTWKP
LKEPGQSVPTFSVTSVLRVDAEAWKQGDKFSCMVGHEALSLSFTQKTIDRLAGDLAFWRP
PSAPKTKVRWGPLPACPLLASQGSSLHRTIGEATDPQCLADCQEPRPWLVLDLPQEDLEE
DTPGASLWPTTVTLLTLFLLSLFYSTALTVTSVRGPADSREGPQY
NT seq 2298 nt   +upstreamnt  +downstreamnt
atgacgtcatatctcagcccaaacgacacctcgtctgccctgtgttccaggcttcgtgtg
cccatgacgcatgggagtgtctgggctgaggagcagccgcccgagtccacagggaagaag
catgcttggcagagacctccattcaccctgaagcttgtcgccactcccctggtggtgtcc
ttcctgggggcagaccatcggctcccgggcgtgcttgaagaagtgaaggatcaaatgggc
acagacaccagctggacccacgctgcccctgggagggctcccagacaccggtactgcccc
ccacccaccccagctgccggagagctggccgaggaaggggagccactggtgacggccaga
ctggagcggttcctcaccctcacatcctcacctgtggccataaggtccactgaggcctgc
tggctcgccagggggtcactctggcctcagccggcctacagcagcaaataccccagagca
gggcggggggctgctgagaccacacagccagcatgcggcctacaggaggccgtggtctcc
atcctcacgccaatcctctggggaggcaggccggtggacgtgcagcactgggccaccagg
caaagggaggcaggcctggcctctcagagcagctcctgcagactcagccagtgcgtggga
gggccacgtgcgcccggatcctgtgtgggagtggcttgtgcccgaggccttccccgagga
gcctgtccaggtggtcgtgcgagaaccctgaggaccacgttcagaaacagcacagctgga
ctcaggcatctggttctgaccccagcttggcacgtgagctgcgtgaccttggggcactca
ctggccatctctgtgcaagtctcctccagtgcacagaagaaaccagctccgtgccaggct
tgtgaggctgcgtcaggggtccgggccgcactcgggccccggcctcacagagcgtcctgt
gttgcagagcccaaaaccagccccagtgtctttccgctgggcctctgcagcgctgccgca
gccgagtacgtggtcatcgcctgcctggtgcaggggttcttcccgccggagcccgtgagc
gtgacctggagccccagcaacgagaatgcaaccgtcaggaacttccctcccgtgaaggcc
gaggcgggggcctcgtacaccatgagcagccagctgaccctgccggccaaccagtgccct
gacgactcggtcctgaagtgccaagtgcagcactcttccaacaccctcccacctgtgtct
gtgccctgcaaagctccagatccgtgtccggttgttcccccctgtaagtgtccctcgtgc
gaccagccccgcctgtcactacgccagcccgcgctcgaggatctgcttctgggctccaac
gccagcctcacgtgcacactgagtggcctgaaagaccccacgggagcctccttcacctgg
aagccctcaggcgggaaggacgccatccagaggagccctgagcaagactcctgcggctgc
tacagcgtaaccagtgtgctgccgggctgtgcggagcagtggaaccgtggggacaccttc
tcctgcgcggccacccaccctgagtccaagagctcattaaccgccaccatcaagaaaccc
acaggaaacaccttccggccccaggtccacctgctcccgccgccgtcggaggagctggcc
ctcaacgagctggtgtccctgacgtgccttgtgaggggcttcagccccgaggacgtgctg
atccgctggctgcagggcacccaggagctgcccccagagaagtacgtgacctggaagccc
ctgaaggagcccggccagagcgtccccaccttctccgtgaccagcgtgctgcgggtagac
gccgaggcctggaagcagggagacaagttctcctgcatggtgggccatgaggccctgtcc
ctgtccttcacccagaagaccatcgaccgcctggcgggggacctggccttctggcgtcct
ccctctgctcccaagaccaaagtgaggtggggacccctacccgcatgcccactgcttgcc
tctcaagggtccagtctccacaggacaataggggaagcaacagacccacagtgtcttgca
gattgccaggagccacgtccctggctggtgctggacctgccacaggaggacctggaggaa
gacaccccaggagccagcctgtggcccaccaccgtcaccctgctcaccctcttcctactg
agtctcttctacagtacagcactgacggtgacaagtgtgcggggcccagccgacagcaga
gagggcccccagtactga

DBGET integrated database retrieval system