KEGG   Ursus arctos horribilis: 113267523
Entry
113267523         CDS       T05909                                 

Gene name
EPO
Definition
(RefSeq) LOW QUALITY PROTEIN: erythropoietin
  KO
K05437  erythropoietin
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04066  HIF-1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04630  JAK-STAT signaling pathway
uah04640  Hematopoietic cell lineage
uah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    113267523 (EPO)
   04066 HIF-1 signaling pathway
    113267523 (EPO)
   04151 PI3K-Akt signaling pathway
    113267523 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113267523 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113267523 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113267523 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113267523 (EPO)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  CSF and other factors
   113267523 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 113267523
NCBI-ProteinID: XP_026371318
UniProt: A0A3Q7XAB8
LinkDB
Position
Unknown
AA seq 277 aa
MNRLGKYSLNLDAYDWDLGGKRNRALKAKQGWEAAWVLRGKLGPEARQDVRTGSQYARTE
EGLQSRLERSGTCEPAPPXPTHSVWHSFLECPALLLLLSLLLLPLGLPVLGAPPRLICDS
RVLERYILEAREAENVTMGCAQGCSFSENITVPDTKVNFYTWKRMDVGQQAVEVWQGLAL
LSEAILRGQALLANSSQLSETLRLHVDKAISSLRSLTSLLRALGAQKEAISLPEEASAAP
LRTFTVDTLCKLFRIYSNFLRGKLTLYTGEACRRGDR
NT seq 834 nt   +upstreamnt  +downstreamnt
atgaaccgtttgggaaaatactcgctaaatctggatgcttacgactgggatctgggaggg
aagcggaaccgggctctgaaggccaagcagggctgggaagctgcctgggtgctgagaggg
aaactgggaccagaggcacggcaggatgtgcggactgggagtcagtatgccaggactgag
gagggactccagagcaggctggagaggagcggaacgtgtgaaccggcccctccanaaccc
acacactcagtctggcactcttttctagaatgtcctgccctgctgcttctgctgtccttg
ctgctgcttcctctgggcctcccagtcctgggcgccccccctcgcctcatttgtgacagc
cgagtcctggagaggtacatcctggaggccagggaggccgaaaatgtcacgatgggctgt
gctcaaggctgcagcttcagcgagaatatcaccgtcccagacaccaaggttaatttctac
acctggaagaggatggacgtcgggcagcaggccgtggaagtctggcagggcctggccctg
ctctcagaagccatcctgcggggccaggccctgttggccaactcctcgcagctgtctgag
accctgcggttgcacgtggacaaagccatcagcagcctgcgcagcctcacctccctgctt
cgggcgctgggagcccagaaggaggccatctcccttccagaggaagcctctgctgctcca
ctccgaacattcactgttgatactttgtgcaaacttttccgaatctactccaatttcctg
cggggaaagctgacgctgtacacaggggaggcctgcaggagaggggacaggtga

DBGET integrated database retrieval system