KEGG   Ursus arctos horribilis: 113267608
Entry
113267608         CDS       T05909                                 

Gene name
IL4R
Definition
(RefSeq) interleukin-4 receptor subunit alpha isoform X1
  KO
K05071  interleukin 4 receptor
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04630  Jak-STAT signaling pathway
uah04640  Hematopoietic cell lineage
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah05200  Pathways in cancer
uah05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113267608 (IL4R)
   04151 PI3K-Akt signaling pathway
    113267608 (IL4R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113267608 (IL4R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113267608 (IL4R)
   04658 Th1 and Th2 cell differentiation
    113267608 (IL4R)
   04659 Th17 cell differentiation
    113267608 (IL4R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113267608 (IL4R)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113267608 (IL4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113267608 (IL4R)
   04090 CD molecules [BR:uah04090]
    113267608 (IL4R)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL2 receptor family
   113267608 (IL4R)
CD molecules [BR:uah04090]
 Proteins
  113267608 (IL4R)
SSDB
Motif
Pfam: IL4Ra_N EpoR_lig-bind IL2RB_N1
Other DBs
NCBI-GeneID: 113267608
NCBI-ProteinID: XP_026371433
UniProt: A0A3Q7WEF1
LinkDB
Position
Unknown
AA seq 811 aa
MGQLCSGLTFPVSCLILVCVAGSGSVKVLQEPSCFSDYVSTSVCQWEMDGPTNCSAELRL
SYQLDFMGSENRTCVPENQEGAVCACSMLMDDVVNADVYQLDLWAGKQRLWGGSFQPSKH
VKPRPPGNLTVHPNVSHTWLLMWTNPYPTQNHLYSELTYMVNISNENDPMDFKVYNVTYM
GPTLRVAASTLKSGASYSARVRAWAQSYNSLWSEWSPSTTWLNYYEPWEQHLPLGISISC
LVILAICLSCYVSIIRIKKGWWDQIPNPAHSPLVAIVIQDPQVSLWGKRSRGQESAKCPH
WKSCLTKLLPCLLEHGVDRDEESSKTARHAPFQPPGKAAWRPVEVSKTVLWPESISVVQC
VELFEAPVDSEEEEEVEEDKRSFCPSPEGSGGSFQEGREDIAARLTESLFLDLLGGETGG
FCPQALEEFCLPPAAGTEGSQGRWAEFPGAGPQETSPQGREQPVHPESTPPASPTQRPVS
PAFLEMPPVIADNPAYRSFGSLLGQSLAPGEADLEPELAERPGEEDAGIPSAPRPSEPPE
SWEQILRQSVLQHQAAPAPGPGPGSGYRDFAGALRQGNAPNAGVAGFGPSGEAGYKAFSS
LLPGTSGGEASHGEGGYKPFQSLTLGGPGAPIPISIPLFTFGLDVEPPRGPQDSLLAAST
PGHLGVEPVGKGGDSHKTLLAPEQATDAFRDDPAGSIVYSALTCHLCGHLKQWHGQEERG
QAQMVPSPCCGCCCGDRSLPLVSPLRAPDALPGGAPLEASLSPASLAPSGVSEEGKSSLS
FQPAPSNAQSSNQTPKRVAVLSTEPTCTSAS
NT seq 2436 nt   +upstreamnt  +downstreamnt
atggggcagctttgctctgggctcacattccctgtgagctgcctgatcctggtatgcgtg
gcaggctccgggagtgttaaggtcctgcaggagcccagctgcttctccgactatgtcagc
acgtctgtctgtcagtgggagatggacggtcccaccaactgcagtgccgagctccgcctg
tcctaccagctggactttatggggtccgagaaccgcacgtgtgtccccgagaaccaagaa
ggtgcggtgtgcgcgtgcagtatgctgatggatgacgtggtcaatgcggacgtctatcag
ctggacctgtgggctgggaaacagcggctgtggggaggctccttccagcccagcaagcac
gtgaagcccaggccccccggaaacctcacggttcaccccaacgtctcccacacgtggctg
ctgatgtggacaaacccgtaccctacccagaatcacctgtactccgagctcacctacatg
gtcaacatttccaatgaaaacgaccccatggacttcaaagtctataacgtgacctacatg
gggcccaccctccgtgtggcggccagcaccctgaagtctggagcttcctacagcgcacga
gtgagggcttgggctcagagctacaacagcttgtggagtgagtggagccccagcaccacg
tggcttaactactacgagccctgggagcagcacctgccgcttggcatcagcatctcctgc
cttgtcatcctggccatctgcctgtcctgctacgtcagcatcatcaggattaagaaagga
tggtgggaccagattccgaacccagcccacagccccctagtggccatagtcatacaggac
ccacaggtgtcactgtgggggaagcggtcccgaggccaggaatccgctaagtgcccacac
tggaagagctgtcttacgaagctcctgccctgtttgctggagcacggcgtggacagggac
gaggagtcctccaagaccgccagacacgcgcctttccagcctcctggaaaagcagcctgg
cgccctgtggaggtgagcaagaccgtcctctggccagagagcatcagtgtggtgcagtgt
gtggagctctttgaggccccggtggacagtgaggaggaggaggaggtggaagaagataaa
agaagcttctgcccatcgcccgagggcagcgggggcagcttccaggagggcagggaagac
atcgcggcccggctgacggaaagcctcttcctggaccttctcgggggggagaccgggggc
ttttgcccacaggctctggaggagttctgccttcctcctgctgcaggaactgagggctcc
caggggcgctgggctgagttcccaggggcggggccgcaggagacgtcgccccagggccgg
gagcagcctgtgcaccccgagtccacccctccggcctctccgacccagcggccagtcagc
ccggctttcctggagatgccccccgtcatcgcagacaaccccgcgtaccgcagcttcggc
agcctcctgggccagtccctagcccccggggaggctgacttggagccagagctggccgaa
cgccccggggaagaagacgccggcatcccctccgccccccggccctcggagccaccggag
agctgggagcagatcctgcgtcagagtgtcctccagcaccaggcggccccggcccctggc
cccggccccggcagcggctaccgggactttgcaggcgctctgaggcagggcaacgccccc
aacgccggggtggcgggcttcggcccttccggggaagcggggtacaaggccttctccagc
ctgctcccagggacatctgggggcgaggccagccatggggaggggggctacaaacccttc
cagagcctcactctaggcggccctggggcccccatccccatctctatccccctgttcacc
tttggactggatgtggagccaccgcgcggccctcaggactcgcttctcgcagccagcacc
ccagggcacctgggtgtggagccagtggggaagggaggggacagccacaagaccctgctg
gccccagagcaggccacagatgccttcagggacgacccggctggcagcatcgtctactcg
gccctcacctgccacctgtgcggccacctgaagcagtggcacggacaggaggagcgtggc
caggcccaaatggtgcccagcccctgctgtggctgctgctgcggggacaggtccttgccc
ctggtgagccccctgagggccccagacgccctgccgggtggggctccgctggaggccagc
ctctctccagcctccctggcaccctcgggagtctcagaggagggcaagtcctccctgtcc
ttccagcctgcccccagcaatgcgcagagctcaaaccagacccccaaaagggtggccgtg
ctctccacagagcccacgtgcacgagcgcttcttag

DBGET integrated database retrieval system