KEGG   Ursus arctos horribilis: 113267622
Entry
113267622         CDS       T05909                                 

Gene name
LAT
Definition
(RefSeq) LOW QUALITY PROTEIN: linker for activation of T-cells family member 1
  KO
K07362  linker for activation of T cells
Organism
uah  Ursus arctos horribilis
Pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04064  NF-kappa B signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04666  Fc gamma R-mediated phagocytosis
uah05135  Yersinia infection
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113267622 (LAT)
   04015 Rap1 signaling pathway
    113267622 (LAT)
   04064 NF-kappa B signaling pathway
    113267622 (LAT)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    113267622 (LAT)
   04660 T cell receptor signaling pathway
    113267622 (LAT)
   04658 Th1 and Th2 cell differentiation
    113267622 (LAT)
   04659 Th17 cell differentiation
    113267622 (LAT)
   04664 Fc epsilon RI signaling pathway
    113267622 (LAT)
   04666 Fc gamma R-mediated phagocytosis
    113267622 (LAT)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113267622 (LAT)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    113267622 (LAT)
SSDB
Motif
Pfam: LAT
Other DBs
NCBI-GeneID: 113267622
NCBI-ProteinID: XP_026371458
UniProt: A0A3Q7XAN9
LinkDB
Position
Unknown
AA seq 258 aa
MEVIVLIPYVLGLLLLPLLAVALCVRCREMPGSYDTGASDSLTPSIMLKRPPTVVPWPSA
TSYAPVTSYPPLSQPDLLPIPRSPQPHRMPSSRQDSDGANSVASYENEGTSGAPGALVAG
RLGPGPGPADRCVATPEPACEDDDEDEEDYHNEGYLEVLPDSTPATSTAVAPAPVPSNPG
LRDSAFSMESGEDYVNVAESEESADVSLDGSREYVNVSQELPPMARTEAAILNSQKVEDE
DDEEEEGAPDYENLQGLH
NT seq 777 nt   +upstreamnt  +downstreamnt
atggaggtcattgtcctgatcccctatgtgctgggcctcctgctgctccctctgcttgct
gtggcgctgtgcgtgcgctgccgggagatgccaggctcttatgacactggtgcctctgat
agcttgaccccaagcatcatgctcaaacggcctcccacggtcgtgccctggccgtcagcc
acctcctacgcacctgttacctcctacccccccctgagccagccggacctgctccctatc
ccgaggtccccacagccccaccgcatgccatcttcccggcaggactcagatggggccaac
agtgtggcgagctacgagaacgagggtacgtctggggccccaggtgccctggtggcaggg
aggctagggcctggcccgggccctgctgatcgctgtgtcgccaccccagagcccgcctgt
gaggacgacgacgaggacgaggaggattatcacaacgagggctacttggaggtgcttcct
gacagcacgccggccaccagcactgctgtcgcaccggctcccgtgcccagcaaccccggc
ctccgagacagcgccttctccatggagtcgggggaggattacgtgaacgtcgctgagagc
gaggagagtgccgacgtgtctctggatgggagccgggagtatgtgaacgtgtcccaggag
ctgccgcccatggctaggaccgaggctgccatcctgaactcccagaaggtggaggatgag
gacgacgaagaggaagagggagctccagattatgagaatctgcaggggcttcactga

DBGET integrated database retrieval system