KEGG   Ursus arctos horribilis: 113267624
Entry
113267624         CDS       T05909                                 

Gene name
CD19
Definition
(RefSeq) B-lymphocyte antigen CD19 isoform X1
  KO
K06465  B-lymphocyte antigen CD19
Organism
uah  Ursus arctos horribilis
Pathway
uah04151  PI3K-Akt signaling pathway
uah04640  Hematopoietic cell lineage
uah04662  B cell receptor signaling pathway
uah05169  Epstein-Barr virus infection
uah05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    113267624 (CD19)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113267624 (CD19)
   04662 B cell receptor signaling pathway
    113267624 (CD19)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    113267624 (CD19)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    113267624 (CD19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:uah04090]
    113267624 (CD19)
CD molecules [BR:uah04090]
 Proteins
  113267624 (CD19)
SSDB
Motif
Pfam: V-set Ig_3 ig Ig_2
Other DBs
NCBI-GeneID: 113267624
NCBI-ProteinID: XP_026371461
UniProt: A0A3Q7WEH8
LinkDB
Position
Unknown
AA seq 559 aa
MPPPLLLFFLLFLTPEGVRPQKTLLVEAKEGAKAELPCLKGPSDGPLEQQAWFRGSQSEL
GYGSQGLGIRKGSLGVQLFVFNVSDQMGGFYLCQLGPPSEQAWQSGWTVSVEGSGELFRW
NASALNDSGCGLGNRSSEGPKPSSGYPTSSQLYVWAKDHPETWEIGPECAPASLNQTFNQ
DLTVARGSTFWLPCEVPPASVARGPISWTHVRPKKHNISLLSLNLREDAPGREMWVLGTL
RGGAVLLLPQATVGDAGIYRCYHGNMTIEMQLKVIAQSAVRYWLLETGGWKVPVVPLLYL
IFCLGSLVSFLHLRRALILRRKRKRMTDPTRRFFKVTPPPGSGAQNQYGNVLSLPTPTSG
TGRALRWAAGLGAAVQSYGSPRSDVPEAGASGSRSPPPAGPEEEEGEAYEEPDSEEGSEF
YENDSNRGQDQLSQDGSGYENPEDGALGPEDEDSFSSAAESYENEDEELAQPVTRTVDFL
SPHGSAWDPSREATSLGSQSYEDMRGILYAAPQLRSIRAQPGPSHEEDADSYENMDMDNP
SGPEPAWGGGGHMGTWSTR
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgccacctcctctccttctcttcttcctcctcttccttacacccgagggagtcaggccc
cagaaaacactgctggtggaggctaaagagggagccaaagctgagctgccatgtctcaaa
ggtccctcagatggtccccttgaacagcaggcctggtttcgggggtctcagtcagagctg
ggctacgggtcccaaggcctgggcatccggaaggggtccctgggcgtccagctgttcgtc
ttcaacgtctctgaccagatggggggcttctacctgtgccagctggggcccccttccgag
caggcctggcagtctggctggacagtcagcgtggaaggcagtggggagctgttccggtgg
aatgcttcggccctaaacgactcaggctgtggcctggggaacaggtcctcagagggcccc
aagccctcttccggttaccccacaagctcccagctgtatgtgtgggccaaagaccaccct
gagacttgggagataggccctgaatgtgccccagccagtctgaaccagaccttcaaccaa
gacctcaccgtggcccgtggctccacattctggctgccctgtgaggtgccccctgcctcc
gtggccagaggccccatctcctggacccacgtgcgccccaagaagcataacatctccttg
ctgagcttaaacctgagggaggatgccccaggcagagagatgtgggtcctgggcaccctc
aggggaggggctgttctgttgctgccccaggccacagttggagatgctggcatctatcgt
tgttaccacggcaacatgaccatcgagatgcagctgaaggtcattgcccagtcagcagta
aggtattggctgctggagactggtggctggaaagtccctgttgtgccattactttatctg
atcttctgcctgggatccctggtgagctttcttcatcttcgaagagccctgatcctcagg
aggaaaagaaagcgaatgaccgatcccaccagaaggttcttcaaagtgacgcctcccccg
ggcagcggggcccagaatcagtacgggaacgtgctctcccttcccacgcccacctccggc
accggacgcgccctgaggtgggctgcaggcctgggggccgccgtccagtcttacggaagc
ccgcgcagcgacgtcccggaggctggagcctcggggtcccggagcccgccgccggcaggc
ccagaagaagaggaaggggaggcctatgaggagccggacagtgaggaaggctccgagttc
tacgagaatgactccaaccgtgggcaggaccaactctcccaggatggcagcggctatgag
aaccccgaggatggggccttgggtcctgaggatgaagactccttctccagcgccgccgag
tcttatgagaatgaggatgaagagctggcccagccagtcaccaggacagtagacttcctg
agcccccatgggtcagcctgggaccccagcagggaagcaacctctcttggctcccagtcc
tatgaggatatgagagggatcctgtatgccgccccccagctccgctccatccgggcccag
cctggacccagtcatgaggaagatgcggactcctatgagaacatggacatggataatccc
agtgggccagaaccagcatggggaggagggggtcacatgggcacctggagcactagatga

DBGET integrated database retrieval system