KEGG   Ursus arctos horribilis: 113267782
Entry
113267782         CDS       T05909                                 

Gene name
LIMK1
Definition
(RefSeq) LIM domain kinase 1 isoform X1
  KO
K05743  LIM domain kinase 1 [EC:2.7.11.1]
Organism
uah  Ursus arctos horribilis
Pathway
uah04360  Axon guidance
uah04666  Fc gamma R-mediated phagocytosis
uah04810  Regulation of actin cytoskeleton
uah05135  Yersinia infection
uah05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113267782 (LIMK1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    113267782 (LIMK1)
  09158 Development and regeneration
   04360 Axon guidance
    113267782 (LIMK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    113267782 (LIMK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113267782 (LIMK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113267782 (LIMK1)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113267782 (LIMK1)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: TKL group
  LISK family [OT]
   113267782 (LIMK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase LIM PDZ Kdo PDZ_6 APH RIO1 PDZ_2 Pkinase_fungal PknG_TPR
Other DBs
NCBI-GeneID: 113267782
NCBI-ProteinID: XP_026371761
UniProt: A0A3Q7WFD3
LinkDB
Position
Unknown
AA seq 647 aa
MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCECSASLS
HQYYEKDGQLFCKRDYWARYGESCHGCSEHITKGLVMVAGELKYHPECFICLTCGTFIGD
GDTYTLVEHSKLYCGHCYYQTVVTPVIEQILPDSPGSRLPHTVTLVSIPASTHGKRGLSV
SIDPPHGLPGCSTEHSHTVRVQGVDPGCMSPDVKNSIHVGDRILEINGTPIRNVPLDEID
LLIQETSRLLQLTLEHDPHDTLGHGPGPEPSLLVSPTHTPSGEVGSSSRQKPVLRSYSID
RSPGAGSLGSPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRE
TGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGT
LRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFG
LARLMVEEKTQPEDLRSLKKADRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLC
EIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKL
EQWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESGLPAHPEVPD
NT seq 1944 nt   +upstreamnt  +downstreamnt
atgaggttgacgctactttgttgcacctggagggaagaacgtatgggagaggaaggaagt
gagttgcccgtgtgtgcgagctgcggccagaggatctatgatggccagtacctccaggcc
ctgaatgctgactggcacgcagattgcttcaggtgttgtgaatgcagtgcctccctctca
caccagtactacgagaaggatgggcagctcttctgcaagagggactactgggcccgctat
ggagagtcctgccacgggtgctcggagcacatcaccaaggggctggtcatggtggccggg
gagctgaaataccaccccgagtgcttcatctgcctcacgtgcgggaccttcatcggggac
ggggacacctacacgctggtggaacactccaagctgtactgtgggcactgctactaccag
actgtggtgacccccgtcatcgagcagatcctgcccgactcccccggctcccgcctgccc
cacacagttaccctagtatccatcccagcctcgactcatggcaaacgtggactctcagtc
tccatcgaccccccacacggtctgccgggctgcagcacagagcactcccacaccgtccgt
gtccagggggtggacccaggctgcatgagccccgatgtgaagaattccatccatgtcgga
gaccggatcctggaaatcaatggcacgcccatccggaatgtgcccctggatgagattgac
ctgctgatccaggaaaccagccgcctgctccagctaactcttgagcatgatccccacgac
acgctgggtcacgggccagggcctgagcccagcctcctggtctccccaactcacactccc
agtggggaggtgggcagctcgtcacggcagaagcctgtcctgaggagctacagcatcgac
aggtctccgggtgccggctcactgggctccccagcctcccagcgcaaggacctggggcgc
tccgaatccctccgcgtggtctgccggccgcaccgcatcttccggccctcagacctcatc
catggggaggtgttgggcaagggctgcttcggacaggccatcaaggtgacgcaccgggag
acgggtgaggtgatggtgatgaaggagctgatccggttcgacgaagagacccaaaggaca
ttcctcaaggaggtgaaggtcatgagatgcctggagcaccccaacgtgctcaagttcatc
ggggtgctctataaggacaagaggctcaacttcatcacagagtacatcaaggggggcacc
ctgcggggcatcatcaagagcatggacagccagtacccgtggagtcagagggtgagcttt
gccaaggacatcgcttcagggatggcctaccttcactccatgaacatcatccaccgggac
ctcaactcccacaactgcctggtccgagagaacaagaacgtggtggtggccgacttcggg
ctggcccggctcatggtggaagaaaagacacagcctgaagacctgcgaagcctcaagaag
gcagaccgcaaaaagcgctacacggtggtgggcaacccctactggatggcgcccgagatg
atcaatggccgcagctatgacgagaaggtagatgtgttttcttttggaatcgtcctgtgc
gagatcattgggcgggtgaatgcggaccctgactacctgccccgcaccatggactttggc
ctcaatgtgcgaggcttcctggaccgttactgccccccaaactgcccgccgagctttttc
cccatcaccgtgcgctgctgtgatctggaccctgagaagaggccctccttcgtgaagctg
gagcaatggctggagaccctccgcatgcacttggccggccacctgccactgggcccgcag
ctggagcagctggacaggggcttctgggagacctaccggcgtggcgagagcggactgcct
gctcaccccgaggtccccgactga

DBGET integrated database retrieval system