KEGG   Ursus arctos horribilis: 113268160Help
Entry
113268160         CDS       T05909                                 

Gene name
IL1A
Definition
(RefSeq) interleukin-1 alpha
  KO
K04383  interleukin 1 alpha
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04060  Cytokine-cytokine receptor interaction
uah04217  Necroptosis
uah04218  Cellular senescence
uah04380  Osteoclast differentiation
uah04640  Hematopoietic cell lineage
uah04932  Non-alcoholic fatty liver disease (NAFLD)
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah04940  Type I diabetes mellitus
uah05020  Prion diseases
uah05133  Pertussis
uah05140  Leishmaniasis
uah05152  Tuberculosis
uah05162  Measles
uah05164  Influenza A
uah05321  Inflammatory bowel disease (IBD)
uah05323  Rheumatoid arthritis
uah05332  Graft-versus-host disease
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113268160 (IL1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113268160 (IL1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113268160 (IL1A)
   04218 Cellular senescence
    113268160 (IL1A)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113268160 (IL1A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113268160 (IL1A)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    113268160 (IL1A)
   05321 Inflammatory bowel disease (IBD)
    113268160 (IL1A)
   05332 Graft-versus-host disease
    113268160 (IL1A)
  09164 Neurodegenerative disease
   05020 Prion diseases
    113268160 (IL1A)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113268160 (IL1A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113268160 (IL1A)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    113268160 (IL1A)
   04933 AGE-RAGE signaling pathway in diabetic complications
    113268160 (IL1A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    113268160 (IL1A)
   05152 Tuberculosis
    113268160 (IL1A)
  09172 Infectious disease: viral
   05162 Measles
    113268160 (IL1A)
   05164 Influenza A
    113268160 (IL1A)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    113268160 (IL1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113268160 (IL1A)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113268160 (IL1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL1 IL1_propep
Motif
Other DBs
NCBI-GeneID: 113268160
NCBI-ProteinID: XP_026372303
UniProt: A0A3Q7XCZ3
LinkDB All DBs
Position
Unknown
AA seq 263 aa AA seqDB search
YNKQNYILIILFNSENEEYSSEIDHLSLNQKSFYDVSYDPLHEDCMSLSTSETSKTSQLT
FKENVVVVATNGKILKKRRLSLNQFITDDDLEAITNDAEEEIMKPRSAAYNFRSNEKYNY
MRIIKSQFILNDNLNQSIIQQTGGNYLMAAALQNLDDAVKFDMGAYTSEDSKLPVTLRIS
KTRLFVSAQNEDEPVLLKEMPETPKTIRDETNLLFFWERHGSKNYFTSVAQPKLFIATQE
RKLVHMARGQPSITDFQILETQP
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
tataataaacagaattacattctcattatcttgtttaacagtgaaaatgaagaatacagt
tctgaaattgaccatctttctctgaatcagaaatctttctatgatgtgagctatgaccca
cttcatgaggactgcatgtctctgagtacctctgaaacctcaaagacatctcagcttact
ttcaaggagaatgtggtggtggtggcaaccaatgggaagattctaaagaagagacggttg
agtttaaatcaattcatcacagatgatgacctggaagccattaccaatgatgcagaagaa
gaaatcatgaagcccagatcagcagcatacaacttccgcagcaacgaaaaatacaactat
atgaggatcatcaaatcccaattcatcctgaatgacaacctcaatcaaagtataattcaa
caaacaggaggaaattacctcatggctgctgcattacagaatctggatgatgcagtgaaa
tttgacatgggagcttacacatcagaagattctaaacttcctgtgactctaagaatctca
aaaacccgactgtttgtgagtgcccaaaatgaagatgagcctgtattgctaaaggagatg
cctgagacacccaaaaccatcagagatgagaccaaccttctcttcttctgggaacgtcat
ggcagtaagaactacttcacatcagttgcccagccaaagttgttcattgccacacaggaa
cgaaaactggtacacatggcaagagggcaaccctctatcactgactttcagatactggaa
acccagccttga

DBGET integrated database retrieval system