KEGG   Ursus arctos horribilis: 113268295
Entry
113268295         CDS       T05909                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah04010  MAPK signaling pathway
uah04012  ErbB signaling pathway
uah04014  Ras signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04915  Estrogen signaling pathway
uah05200  Pathways in cancer
uah05210  Colorectal cancer
uah05211  Renal cell carcinoma
uah05212  Pancreatic cancer
uah05214  Glioma
uah05215  Prostate cancer
uah05223  Non-small cell lung cancer
uah05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113268295 (TGFA)
   04012 ErbB signaling pathway
    113268295 (TGFA)
   04014 Ras signaling pathway
    113268295 (TGFA)
   04151 PI3K-Akt signaling pathway
    113268295 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    113268295 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113268295 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113268295 (TGFA)
   05212 Pancreatic cancer
    113268295 (TGFA)
   05225 Hepatocellular carcinoma
    113268295 (TGFA)
   05214 Glioma
    113268295 (TGFA)
   05211 Renal cell carcinoma
    113268295 (TGFA)
   05215 Prostate cancer
    113268295 (TGFA)
   05223 Non-small cell lung cancer
    113268295 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113268295 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2 TMEM154
Other DBs
NCBI-GeneID: 113268295
NCBI-ProteinID: XP_026372466
UniProt: A0A3Q7WHF7
LinkDB
Position
Unknown
AA seq 157 aa
MRVCLVLEWLLESEGALQMTAKCLFSPPADPPVAAAVVSHFNDCPDSHSQFCFHGTCRFL
VQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIIACVLIHC
CQVRKHCEWCQALICRHEKPSALLKGRTTCCHSETVV
NT seq 474 nt   +upstreamnt  +downstreamnt
atgcgagtgtgtctggtcctggaatggctgttagaaagtgagggagcgctgcagatgaca
gccaaatgtcttttctctcccccagcagacccgcctgtggccgcagctgtggtgtcccat
tttaatgactgcccagattcccacagtcagttctgcttccatggaacctgcaggtttttg
gtgcaggaagacaagccagcgtgcgtctgccattctgggtacgtgggcgcgcgctgtgag
catgccgacctcctggccgtggtggctgccagccagaagaagcaggccatcaccgccttg
gtggtggtctccatcgtggccctggccgtcctcatcatcgcgtgtgtgctgatacactgc
tgccaggtccgaaaacactgtgagtggtgccaggctctcatctgccggcacgagaagccc
agtgccctgctgaagggaaggaccacttgctgccactcagaaacagtggtctga

DBGET integrated database retrieval system