KEGG   Ursus arctos horribilis: 113268543
Entry
113268543         CDS       T05909                                 

Gene name
CDC42
Definition
(RefSeq) cell division control protein 42 homolog isoform X1
  KO
K04393  cell division control protein 42
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04062  Chemokine signaling pathway
uah04144  Endocytosis
uah04360  Axon guidance
uah04370  VEGF signaling pathway
uah04510  Focal adhesion
uah04520  Adherens junction
uah04530  Tight junction
uah04660  T cell receptor signaling pathway
uah04666  Fc gamma R-mediated phagocytosis
uah04670  Leukocyte transendothelial migration
uah04722  Neurotrophin signaling pathway
uah04810  Regulation of actin cytoskeleton
uah04912  GnRH signaling pathway
uah04932  Non-alcoholic fatty liver disease (NAFLD)
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah05100  Bacterial invasion of epithelial cells
uah05132  Salmonella infection
uah05135  Yersinia infection
uah05165  Human papillomavirus infection
uah05200  Pathways in cancer
uah05203  Viral carcinogenesis
uah05205  Proteoglycans in cancer
uah05211  Renal cell carcinoma
uah05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113268543 (CDC42)
   04015 Rap1 signaling pathway
    113268543 (CDC42)
   04010 MAPK signaling pathway
    113268543 (CDC42)
   04370 VEGF signaling pathway
    113268543 (CDC42)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113268543 (CDC42)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113268543 (CDC42)
   04520 Adherens junction
    113268543 (CDC42)
   04530 Tight junction
    113268543 (CDC42)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113268543 (CDC42)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    113268543 (CDC42)
   04666 Fc gamma R-mediated phagocytosis
    113268543 (CDC42)
   04670 Leukocyte transendothelial migration
    113268543 (CDC42)
   04062 Chemokine signaling pathway
    113268543 (CDC42)
  09152 Endocrine system
   04912 GnRH signaling pathway
    113268543 (CDC42)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    113268543 (CDC42)
  09158 Development and regeneration
   04360 Axon guidance
    113268543 (CDC42)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113268543 (CDC42)
   05205 Proteoglycans in cancer
    113268543 (CDC42)
   05203 Viral carcinogenesis
    113268543 (CDC42)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    113268543 (CDC42)
   05211 Renal cell carcinoma
    113268543 (CDC42)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    113268543 (CDC42)
   04933 AGE-RAGE signaling pathway in diabetic complications
    113268543 (CDC42)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113268543 (CDC42)
   05135 Yersinia infection
    113268543 (CDC42)
   05100 Bacterial invasion of epithelial cells
    113268543 (CDC42)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    113268543 (CDC42)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113268543 (CDC42)
   03036 Chromosome and associated proteins [BR:uah03036]
    113268543 (CDC42)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113268543 (CDC42)
   04031 GTP-binding proteins [BR:uah04031]
    113268543 (CDC42)
Membrane trafficking [BR:uah04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    113268543 (CDC42)
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    113268543 (CDC42)
  Macropinocytosis
   Ras GTPases
    113268543 (CDC42)
Chromosome and associated proteins [BR:uah03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    113268543 (CDC42)
Exosome [BR:uah04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   113268543 (CDC42)
  Exosomal proteins of breast milk
   113268543 (CDC42)
GTP-binding proteins [BR:uah04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    113268543 (CDC42)
SSDB
Motif
Pfam: Ras Roc Arf PET117 GTP_EFTU
Other DBs
NCBI-GeneID: 113268543
NCBI-ProteinID: XP_026372895
UniProt: A0A3Q7X698
LinkDB
Position
Unknown
AA seq 191 aa
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagacaattaagtgtgttgttgtgggcgatggtgccgttggtaaaacatgtctcctg
atatcctacacaacaaacaaatttccatctgagtatgtaccgactgtttttgacaactat
gcagtcacagttatgattggtggagagccatatactcttggactttttgatactgcaggg
caagaggattatgacagattacgaccgctgagttatccacaaacagatgtatttctagtc
tgtttttcagtggtctctccatcctcatttgaaaatgtgaaggaaaagtgggtgcctgag
ataactcaccattgtccaaagactcctttcttgcttgttgggacccaaattgatctccga
gatgacccctctacgattgagaaacttgccaagaacaaacagaagcctatcactccagag
actgctgaaaagctggcccgtgacctgaaggcggtcaagtatgtggagtgttctgcactc
acacagaaaggcctaaagaatgtatttgacgaagcaatattggctgccctggagcctcca
gaaccgaagaagagccgcaggtgtgtgctgctatga

DBGET integrated database retrieval system