KEGG   Ursus arctos horribilis: 113268946
Entry
113268946         CDS       T05909                                 

Definition
(RefSeq) regakine-1-like
  KO
K05408  C-C motif chemokine 3
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04062  Chemokine signaling pathway
uah04620  Toll-like receptor signaling pathway
uah05142  Chagas disease (American trypanosomiasis)
uah05163  Human cytomegalovirus infection
uah05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113268946
   04061 Viral protein interaction with cytokine and cytokine receptor
    113268946
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113268946
   04062 Chemokine signaling pathway
    113268946
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    113268946
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    113268946
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    113268946
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113268946
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113268946
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Chemokines
   113268946
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Chemokines
   113268946
SSDB
Motif
Pfam: IL8 BRI3BP
Other DBs
NCBI-GeneID: 113268946
NCBI-ProteinID: XP_026373367
UniProt: A0A3Q7Y6I1
LinkDB
Position
Unknown
AA seq 93 aa
MKVILALLVFLLILVALHSEANEESVKLNPVVCCFAYTTRKVPLRFVKGYDRTSDQCSTP
GVIFLTRHNRQICANPDVPWVQEYIRHLDNMSN
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaaggtcatcctggctctcctggtcttcctcctcattcttgttgcccttcactctgag
gccaatgaagaatcagttaaattaaaccccgttgtgtgctgttttgcctacaccacacgg
aaagtcccactccggtttgtgaaaggttatgatagaaccagtgaccagtgctccacccca
ggggtcatcttccttacccgacataaccgacagatctgtgccaaccccgatgttccctgg
gtgcaggagtacatcagacacttagacaacatgtctaactga

KEGG   Ursus arctos horribilis: 113268947
Entry
113268947         CDS       T05909                                 

Definition
(RefSeq) C-C motif chemokine 3-like
  KO
K05408  C-C motif chemokine 3
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04062  Chemokine signaling pathway
uah04620  Toll-like receptor signaling pathway
uah05142  Chagas disease (American trypanosomiasis)
uah05163  Human cytomegalovirus infection
uah05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113268947
   04061 Viral protein interaction with cytokine and cytokine receptor
    113268947
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113268947
   04062 Chemokine signaling pathway
    113268947
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    113268947
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    113268947
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    113268947
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113268947
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113268947
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Chemokines
   113268947
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Chemokines
   113268947
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 113268947
NCBI-ProteinID: XP_026373368
UniProt: A0A3Q7XG04
LinkDB
Position
Unknown
AA seq 93 aa
MEVPAAALAVLLLTAALCSQTYSSSFGADTPTSCCFFYISRQIPQKFVVDYYETSSQCSK
PGVIFQTKRGRQICADPREAWVQEYISDLELNA
NT seq 282 nt   +upstreamnt  +downstreamnt
atggaggtccccgcggctgccctggccgtcctgcttctcaccgcggcactctgttcccag
acctactcttcctcttttggtgctgacaccccgacttcctgctgcttcttctatatctcc
cggcagattcctcagaaatttgtggtcgactattacgagaccagcagccagtgttccaag
cccggtgtcatcttccaaaccaaaagaggccggcagatctgtgctgaccccagggaggcc
tgggtccaggagtacatcagcgacctggagctgaatgcctga

KEGG   Ursus arctos horribilis: 113268948
Entry
113268948         CDS       T05909                                 

Definition
(RefSeq) C-C motif chemokine 3-like
  KO
K05408  C-C motif chemokine 3
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04062  Chemokine signaling pathway
uah04620  Toll-like receptor signaling pathway
uah05142  Chagas disease (American trypanosomiasis)
uah05163  Human cytomegalovirus infection
uah05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113268948
   04061 Viral protein interaction with cytokine and cytokine receptor
    113268948
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113268948
   04062 Chemokine signaling pathway
    113268948
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    113268948
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    113268948
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    113268948
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113268948
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113268948
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Chemokines
   113268948
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Chemokines
   113268948
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 113268948
NCBI-ProteinID: XP_026373369
UniProt: A0A3Q7Y0A9
LinkDB
Position
Unknown
AA seq 93 aa
MKVPGAVLAVLLCTMALYSQVFSAPFGADTPTACCFSYVSKPIPRKFIVDYFETSSQCSK
PGVIFQTRKGRQACADPSEAWVQEYVTDLELNA
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaaggtccccggggctgtgctcgccgtcctcctctgcaccatggccctctacagccag
gtcttctctgcaccatttggtgctgacaccccaaccgcctgctgcttctcctacgtctcc
aagccgattccacgcaagttcatagtcgactattttgagaccagcagccaatgctccaag
cctggtgttatcttccagaccagaaaaggccgccaggcctgtgccgaccccagtgaggcc
tgggtccaggagtacgtgaccgacctggagctgaatgcctga

DBGET integrated database retrieval system