KEGG   Ursus arctos horribilis: 113269018
Entry
113269018         CDS       T05909                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible isoform X1
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
uah  Ursus arctos horribilis
Pathway
uah00220  Arginine biosynthesis
uah00330  Arginine and proline metabolism
uah01100  Metabolic pathways
uah04020  Calcium signaling pathway
uah04066  HIF-1 signaling pathway
uah04146  Peroxisome
uah04371  Apelin signaling pathway
uah04926  Relaxin signaling pathway
uah05010  Alzheimer disease
uah05014  Amyotrophic lateral sclerosis
uah05022  Pathways of neurodegeneration - multiple diseases
uah05133  Pertussis
uah05140  Leishmaniasis
uah05142  Chagas disease
uah05145  Toxoplasmosis
uah05146  Amoebiasis
uah05152  Tuberculosis
uah05200  Pathways in cancer
uah05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    113269018 (NOS2)
   00330 Arginine and proline metabolism
    113269018 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    113269018 (NOS2)
   04066 HIF-1 signaling pathway
    113269018 (NOS2)
   04020 Calcium signaling pathway
    113269018 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    113269018 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    113269018 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113269018 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    113269018 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113269018 (NOS2)
   05014 Amyotrophic lateral sclerosis
    113269018 (NOS2)
   05022 Pathways of neurodegeneration - multiple diseases
    113269018 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    113269018 (NOS2)
   05152 Tuberculosis
    113269018 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    113269018 (NOS2)
   05145 Toxoplasmosis
    113269018 (NOS2)
   05140 Leishmaniasis
    113269018 (NOS2)
   05142 Chagas disease
    113269018 (NOS2)
Enzymes [BR:uah01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     113269018 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 113269018
NCBI-ProteinID: XP_026373469
UniProt: A0A3Q7Y0G7
LinkDB
Position
Unknown
AA seq 1157 aa
MACPWQLLFKAKSYRFDLTEETDINNNVGKASQAPSSLVTQDDPKCHSLGKHRNESPQSL
TGTVKTSPESLIKLDSPPSACPRHVRIKNWGSGMTFQDTLHHKAKGDIACKSKSCLGAIM
NPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAKEMFEHICRHLRYATNNGNI
RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGTILGDPASVEFTQLCIDLGWKPKYS
RFDVVPLVLQADGQDPEFFEIPPDLVLEVPMEHPKYEWFHELQLKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDRAVVEINV
AVLHSFQKRNVSIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPISGSITPVFHQEM
LNYVLSPFYYYQVEAWKTHTWQDEKRRPRRRKIPFKVLVKAVLFSAMLMRKTMASRVRAT
ILFATETGKSETLARDLGALFSCAFNPKVLCMDEYRLRHLEDEQLLLVVTSTFGNGDSPG
NGEKLKKSLFLLKELTNKFRYAVFGLGSSMYPQFCAFAHDIDQKLSHLGASQLAPTGEGD
ELSGQEEAFRSWAVQTFKAACETFEVRGKHRIQIPRLYTCNVTWDPQHYRLVQDSQPLDL
ERALSSMHAKKVFTLRLKSQRNLQSPQSSRTTLLVELSCEDSRGLSYLPGEHLGVCPSNQ
LALVQGILERVVDGPSPHQPVHLEILSENGSYWVRDKRLPPCSLSQALTHFLDITTPPTP
LLLRKLAQLATEEAERQRLETLCQPSEYNKWKFTNNPTFLEVLEEFPSLRVSAGFLLSQL
PILKPRYYSISSSRDRTPTEVHLTVAVLTYRTRDGQGPLHHGVCSTWLSSLKPQDPVPCF
VRSASNFQLPEDPSHPCILIGPGTGIAPFRGFWQQRLHDTKYKGLQAGRMTLVFGCRRPD
EDHLYREEMLEMAQNGVLHEVHTAYSRLPCQPKVYVQDILRQRLASEVLRVLHEEHGHLY
VCGDVRMARDVAHTLKLLVAAKLRLSEEQVEDYFFQLKSQKRYHEDIFGAVFPYEVKKDG
AAKQPSDPKVTTAYGRS
NT seq 3474 nt   +upstreamnt  +downstreamnt
atggcctgtccctggcaactcctgttcaaggccaaatcctaccggttcgacttgaccgag
gaaacagacatcaacaacaatgtggggaaagccagccaggccccctccagtctagtgaca
caggatgaccccaagtgtcacagcctcggcaagcaccggaatgagtccccccagtcgctc
acagggacagtaaagacgtctccagaatccctgatcaagctggattcacccccatcggcc
tgcccgcggcatgtgaggatcaaaaactggggcagtggaatgaccttccaagacacactt
caccataaggccaaaggggatatcgcttgcaagtccaagtcttgtctgggagccatcatg
aaccccaaaagtttgaccagaggacccagggacaagcctacccccccagacgagcttctg
cctcaagctattgaatttgtcaaccaatattatggttccttcaaagaggcaaaaatagag
gaacatctggccagggtggaagcggtaacaaaggagatagaaacaacaggaacctatcag
ctgacgggggatgagctcatcttcgccaccaagcaggcctggcgcaacgctccccgctgc
atcgggaggatccagtggtccaacctgcaggtcttcgacgcccggagctgttccactgcc
aaggaaatgttcgagcacatctgcagacacctgcggtatgccaccaacaacggcaacatc
aggtcggccatcaccgtgttcccccagcggagcgatgggaagcatgacttccgggtctgg
aacgctcagctcattcggtatgccggctaccagatgcctgatggcaccatcctgggggac
cccgccagcgtggagtttacccagctgtgcatcgacctgggctggaagcccaagtacagt
cgcttcgacgtggtgcccctggtgctgcaggcggatggccaagatccggagttcttcgaa
atcccacctgaccttgtgctcgaggtgcccatggaacatcccaagtacgagtggttccat
gagctccagctgaagtggtatgccctgcctgcagtggccaacatgctgcttgaggtgggc
ggcctcgagttcccggggtgccccttcaacggctggtacatgggcacggagatcggggtc
cgggacttctgtgacgttcagcgttacaacattctggaggaagtgggcagaaggatgggc
ctggaaacgcacaagctggcctcactctggaaggaccgggctgtcgttgagatcaatgtc
gctgtgctccacagtttccagaagcggaatgtgagcatcatggaccaccactcagctgca
gagtcgttcatgaagtacatgcagaacgagtaccgttcccgagggggctgcccggccgac
tggatttggctggtccccccgatttctgggagcatcactcctgtgttccaccaggagatg
ctaaactatgtcctgtcccctttctactactaccaggtggaagcctggaaaacccacacc
tggcaggatgagaagcggagaccccggagaagaaagattccattcaaagtcttggtgaaa
gctgtgctcttctccgccatgctgatgcgcaagaccatggcttcccgagtcagagccaca
atcctctttgcgacggagacaggaaagtcagaaacgctggcccgggacctgggggccttg
ttcagctgcgccttcaaccccaaggttctctgcatggacgagtataggctgcgccatctg
gaggacgagcagctgctcctggtggtgaccagcacgtttgggaatggagactcccctggc
aacggagagaaactgaaaaaatctctcttcttgctgaaagagcttaccaacaagttcagg
tatgccgtgttcggcctcggctccagcatgtaccctcagttctgtgcctttgctcatgac
atcgaccagaagctgtcccatctgggggcctctcagctcgccccaacaggggaaggggac
gagctcagtgggcaggaggaagccttccgcagctgggccgtgcaaacctttaaggcggcc
tgtgagacgttcgaggtgcgaggcaaacaccgcattcagatccccaggctctacacctgc
aacgtgacatgggacccacagcactacaggctcgtgcaggactcacagcctctggacctc
gagagagccctcagcagtatgcatgccaagaaggtgttcaccctgaggctgaaatcacag
cggaatctacagagtccccagtccagccgcaccaccctcctggtggagctctcctgtgag
gacagccgcgggctgagctacttgcctggagagcacctcggggtttgccccagcaaccag
ctggccctggtgcaaggcatcttggaaagagtggtagacggcccctcaccccaccagcct
gtgcacctggagatcctcagtgagaacggaagctactgggtcagagataagcggctgccc
ccgtgctcactcagccaggccctcacccacttcctggacatcaccacccccccaaccccg
ctgctgctccgaaagctggcacagctggccacggaagaggccgagaggcagaggctagag
accctgtgccagccctcagaatacaacaagtggaagttcaccaacaaccccacattcctg
gaggtgctggaggagttcccgtccctgcgggtgtctgctggcttcctgctctcccagctc
cctattctgaaaccccggtactactccatcagctcctccagggatcgcacacccacggag
gtgcacctcaccgtggccgtgctcacgtaccgcacccgagatggccaaggtcccttgcac
cacggtgtctgtagcacgtggctcagtagcctgaagccccaagacccagtaccctgcttc
gtgagaagtgccagcaacttccagctccctgaggacccctcccatccttgcatcctcatc
ggacctggcacaggcatcgcccccttccgcggtttctggcagcagcggctccatgacacc
aagtacaaagggctccaggccggccgcatgaccctggtgttcgggtgccgccgcccagat
gaggaccacctgtatcgggaggagatgctggagatggcccagaatggggtactgcatgag
gtgcacacagcctactctcgcctgccttgccagcccaaggtctatgttcaagacatcctg
cggcagcggctggccagcgaggtgctccgcgtgctgcacgaggagcacggccacctttat
gtctgtggggatgtgcgtatggcccgggatgtggcccataccctgaagctcctggtggct
gccaagctgaggctgagtgaggagcaggtggaggactactttttccagcttaagagccag
aagcgctatcatgaagatatctttggtgctgtgtttccctacgaggtgaaaaaagatggg
gcagcgaagcagcccagcgatcccaaagttacaacagcctacgggagaagttaa

DBGET integrated database retrieval system