KEGG   Ursus arctos horribilis: 113269180
Entry
113269180         CDS       T05909                                 

Gene name
CCL1
Definition
(RefSeq) C-C motif chemokine 1
  KO
K05514  C-C motif chemokine 1
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113269180 (CCL1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113269180 (CCL1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    113269180 (CCL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113269180 (CCL1)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Chemokines
   113269180 (CCL1)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 113269180
NCBI-ProteinID: XP_026373707
UniProt: A0A3Q7Y6X1
LinkDB
Position
Unknown
AA seq 94 aa
MKLLTMALACLLLAGMWLRDVDGRSMLVSSSNCCFKFADKKISQQQIQCYKHTSSTCSRR
SLILKLKGGRETCVMESAPWVKPHLKTMKPCPPK
NT seq 285 nt   +upstreamnt  +downstreamnt
atgaagctcctcaccatggccctggcgtgcctgctactagctgggatgtggcttcgagac
gtggacggcaggagcatgcttgtgtcgtcctccaactgttgcttcaagtttgcggataaa
aagatttcccagcagcaaatccagtgttacaaacatacgagctccacctgctcccgcagg
agtctaatactcaagctgaagggcggcagagagacctgtgtcatggagtcagccccatgg
gttaagcctcatttaaaaactatgaaaccgtgcccaccaaagtaa

DBGET integrated database retrieval system