KEGG   Ursus arctos horribilis: 113269244
Entry
113269244         CDS       T05909                                 

Gene name
TPO
Definition
(RefSeq) LOW QUALITY PROTEIN: thyroid peroxidase
  KO
K00431  thyroid peroxidase [EC:1.11.1.8]
Organism
uah  Ursus arctos horribilis
Pathway
uah00350  Tyrosine metabolism
uah01100  Metabolic pathways
uah04918  Thyroid hormone synthesis
uah05320  Autoimmune thyroid disease
Module
uah_M00043  Thyroid hormone biosynthesis, tyrosine => triiodothyronine/thyroxine
Brite
KEGG Orthology (KO) [BR:uah00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    113269244 (TPO)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    113269244 (TPO)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113269244 (TPO)
Enzymes [BR:uah01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.8  iodide peroxidase
     113269244 (TPO)
SSDB
Motif
Pfam: An_peroxidase EGF_CA EGF_3 cEGF FXa_inhibition
Other DBs
NCBI-GeneID: 113269244
NCBI-ProteinID: XP_026373743
UniProt: A0A3Q7XH67
LinkDB
Position
Unknown
AA seq 980 aa
MLHHLTSELMAQPFLHEHFQMQAVLQMRLAVCSSPDTDQDPRASRSLSPSSASGDSVRCP
RRCREDCLHHSGRDGDSPLISVVEESRRMVDSAIYHTMRRDLSKREIPSPSRLLSFSKLP
EPTSRAISRAAEIMEASVRALKTRVYGKLGRSRPPTDVLPEDVLNTIANVSGCLPYMLPP
RCPNTCLASKYRLITGACNNRDHPRWGAANTALARWLPPAYEDGISEPRGWNPHFLYNGF
PLPPVREVTRQVIQVPNEAVTEDDQYSDLLMVWGQYIDHDIAFTPQSTSKAAFGGGADCQ
LTCENQNPCFPIQLPANASGTAGGACLPFYRSSAACGTGIHGAFFGNVTSANPRQQMNGL
TSFLDASTVYGSSPALEKQLRNWTSAEGLLRVNTRHWDAGRAYLPFTRPPAPTACMPEPG
TRGTAGAPCFLAGDGRASEVPALTAVHTLWLREHNRLASALKALNAHWSADTAYQEARKV
VGALHQIITMRDYVPKVLGPEAFQQHVGPYEGYDPAVDPTVSNVFSTAAFRFGHATVHPL
VRRLDARFQEHPALPPLRLQDAFFSPWRLLKEGGVDPLVRGLLARPAKLQVQDQLMNEEL
TERLFVLGSSGGLDLASINLQRGRDHGLPGYNAWREFCGLPRLETRADLRSAITNASIAG
RIMDLYGHPDNIDVWLGGLAETFLPQARTGPLFACLIGKQMKALRDGDRFWWESSGVFTE
AQRRELARHSLSRVICDNTGLPSVPADTFQIGRFPQDFESCENIPGLNLDMWREALPQGD
ACSLPDGVDDGDVTLCGESGRRVLVFFCHHGFQLQGQEQVACSPRGADLRPPVCRDINEC
EDVTPPPCHPSARCRNTKGSFRCECTDPYVLGEDGATCVDSGRLPKASLVSIALGALLVG
GLAGLTWMVICRWTHTGRKASLHIADTGGRGTCQPGRGTRRDTSVSSLVPLLGVQGRTRP
VDPKSFSASRSHSGARGSRA
NT seq 2943 nt   +upstreamnt  +downstreamnt
atgcttcatcatctgacctctgaactcatggcccagcctttcctccatgaacattttcaa
atgcaagctgttctccagatgagacttgccgtatgttcaagtcctgacacagaccaggac
ccgcgcgccagcaggagcctcagtccctcctctgcaagtggagacagcgtccggtgcccg
cgaaggtgtcgtgaggactgcctacatcactcagggcgggacggagactctcctctcatc
agcgtcgtggaagagagcaggcgcatggtggacagtgccatctaccacaccatgaggaga
gacctcagcaaaagagagatcccatctccatcacggcttctgtctttctccaaactccct
gagccaaccagcagagccatctcccgagcggccgagatcatggaagcttccgtgcgggcc
ctgaagacaagagtctacgggaagctcgggcgatctcggccacccaccgatgtcctgccg
gaagatgtgctgaacacaattgcgaacgtgtccggatgcctgccttacatgctgcccccc
cgatgtccaaacacctgcctggccagcaagtacaggctcatcacgggcgcctgcaacaac
agagaccaccccaggtggggagctgccaacacagccctggcgagatggctgccgcctgcc
tacgaagacggcatcagtgagcccagagggtggaacccccacttcctgtacaacggcttc
ccactgcccccggtccgggaggtgacaagacaagtcatccaggtccccaacgaggccgtc
acagaggatgaccaatattctgacctcctgatggtgtgggggcagtatattgatcacgac
atcgcgttcacacctcagagtactagcaaagctgcatttgggggaggagctgattgccag
ctgacctgtgaaaaccaaaacccatgttttcccatacagctgcccgccaatgcctcaggg
accgcggggggcgcctgtttgccgttttaccgctcctctgccgcctgtggcaccgggatc
cacggcgccttcttcggcaacgtgacctcggccaacccgcgacagcagatgaacgggctg
acctctttcctggacgcgtccaccgtgtacggcagctccccggccttggagaagcagctg
cgcaactggaccagtgctgaggggctgctccgcgtcaacacgcgccactgggacgccggc
cgcgcctacctgcccttcacgcggcctcctgcacccacagcctgcatgcctgagcccggc
acccgcgggacggccggggcaccctgcttcctggcaggggatggccgagccagcgaagtc
cccgctctgacggccgtgcacacgctgtggctgcgcgagcacaaccgcctggcctctgcg
ctcaaggctctcaacgcgcactggagcgccgacacggcctaccaggaggcgcgcaaggtg
gtgggcgccctgcaccagatcatcaccatgcgagactatgtccccaaagtcctgggccct
gaggccttccagcaacacgtgggcccctatgagggctacgaccctgccgtggaccccacc
gtgtccaacgtgttttccacagctgctttccgcttcggccatgccacagtgcacccactg
gtgaggcggctggacgcccgcttccaggagcaccctgccctccccccgttgcggctgcag
gatgccttcttcagcccctggaggctcctcaaggaaggcggtgtggaccccctggtgcgg
ggccttctcgcgagaccagccaagctgcaggtgcaggaccagctgatgaacgaggagctg
acagagaggctgttcgtgctggggagctcgggcgggctggacctggcatcgattaacctg
cagcggggccgggaccacggcctgccaggctacaacgcgtggagggagttctgcggcctg
cccagactggagacgcgggccgacctgcgctccgccatcaccaacgcgagcatcgcgggc
cgcataatggacctgtatgggcaccccgacaacatcgacgtctggctgggcggcctagcc
gagaccttcctgccccaggcgcgcacgggtccgctgtttgcgtgcctcattgggaaacag
atgaaggccctgagggacggagaccggttctggtgggagagcagcggagtgttcaccgag
gcccaacggcgcgagctggcgaggcattccctatcccgggtcatctgtgacaacacgggc
ctccccagcgtgcccgcggacaccttccaaatcgggagattcccgcaggactttgagtcc
tgtgagaacattccaggtctgaacctggacatgtggagggaggcccttcctcaaggtgac
gcatgcagcctcccggatggcgtggacgacggggacgtcacgctctgtggcgagtcgggg
cggcgcgtgctggtgttcttctgccaccacgggttccagctgcaaggccaggagcaggtg
gcctgctcccccaggggcgcggatctccggccccccgtctgcagagatatcaacgagtgt
gaagacgtgacaccccctccctgccatccgtcggcccggtgtaggaacaccaagggcagc
ttcaggtgcgagtgcacagacccctacgtgctgggggaggacggagcgacgtgtgtagac
tctgggaggctcccgaaggcgtccttggtctccatcgcgttgggcgccctgctggttggc
ggcctggcaggtctcacctggatggtgatttgcaggtggacacacaccggccgtaaagcc
tcactgcacatcgcagacacaggtggaagaggcacctgccagccaggtcgtggaacacgc
cgggacacgagtgtgtcaagcctggtgcccctgctgggcgtgcagggcaggacccggcct
gtggatcccaaatccttctctgccagtaggagccacagtggcgcgcgtggaagccgggcg
tga

DBGET integrated database retrieval system