KEGG   Ursus arctos horribilis: 113269696
Entry
113269696         CDS       T05909                                 

Gene name
RORA
Definition
(RefSeq) nuclear receptor ROR-alpha isoform X1
  KO
K08532  RAR-related orphan receptor alpha
Organism
uah  Ursus arctos horribilis
Pathway
uah04659  Th17 cell differentiation
uah04710  Circadian rhythm
uah05017  Spinocerebellar ataxia
uah05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    113269696 (RORA)
  09159 Environmental adaptation
   04710 Circadian rhythm
    113269696 (RORA)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113269696 (RORA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    113269696 (RORA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:uah03000]
    113269696 (RORA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:uah03310]
    113269696 (RORA)
Transcription factors [BR:uah03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone-like
    113269696 (RORA)
Nuclear receptors [BR:uah03310]
 1. Thyroid hormone like
  1F. RAR-related orphan receptor
   113269696 (RORA)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 113269696
NCBI-ProteinID: XP_026374395
UniProt: A0A3Q7XAB3
LinkDB
Position
Unknown
AA seq 523 aa
MESAPAAPDPAASEPGSSGADAAAGARETPLNQESARKSEPPAPVRRQSYSSTSRGISVT
KKTHTSQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRT
SRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQPGEAE
PLTPTYNISANGLTELHEDLSNYIDGHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIK
PEPICDYTPASGFFPYCSFTNGETSPTVSMAELEHLAQNISKSHLETCQYLREELQQITW
QTFLQEEIESYQNKQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAGS
LEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEI
ALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRAL
CGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggagtcagctccggcagcccccgaccccgccgccagcgagccgggcagcagcggcgcg
gacgcggccgccggcgccagggagaccccgctgaaccaggaatccgcccgcaagagcgag
ccgcccgccccggtgcgcagacagagctattccagcaccagcagaggtatctcagtaacg
aagaagacacatacatctcaaattgaaattattccttgcaagatctgtggagacaaatca
tcaggaatccattatggtgtcattacatgtgaaggctgcaagggctttttcaggagaagt
cagcaaagcaatgccacctactcctgtcctcgtcagaagaactgtttgattgatcgaacc
agtagaaaccgctgccaacactgtcgattacagaaatgccttgccgtagggatgtctcga
gatgctgtaaaatttggccggatgtcaaaaaagcaaagagacagcttgtacgcagaagta
caaaaacaccggatgcagcagcagcagcgagaccaccaacagcagcctggagaggccgag
ccgctgactcccacctacaacatctcggccaacgggctcaccgagcttcacgaggacctc
agcaactacatcgacgggcacaccccggaggggagcaaggcagactctgctgtcagcagc
ttctacctggacatacagccttccccagaccagtcaggtcttgatatcaatggaatcaaa
ccagaaccaatatgtgactacacaccagcatcaggcttctttccctactgttctttcacc
aacggagagacttccccaactgtgtccatggcagaattagaacaccttgcacagaatata
tctaaatcacatctggaaacttgccaatacttgagagaagagctccagcagataacgtgg
cagacctttctgcaggaggagatagagagctaccaaaacaagcagcgggaggtgatgtgg
cagttgtgtgccatcaaaatcacggaagctatacagtacgtggtggagtttgccaaacgc
attgacggatttatggaactgtgtcaaaatgatcagattgtgcttctcaaagcaggttct
ctagaggtggtgtttatcagaatgtgccgtgccttcgactctcagaacaacaccgtgtac
tttgatgggaaatatgctagccccgatgtcttcaaatccttgggttgtgaagactttatt
agctttgtatttgaatttgggaagagtttatgttctatgcacctgactgaagatgaaatt
gcattattttctgcatttgtactaatgtcagcagatcgctcgtggctgcaggaaaaggta
aaaattgaaaaactgcaacagaaaattcagctagctcttcaacacgtcctgcagaagaat
caccgagaagatggaatcctaacaaagttaatatgcaaggtgtctacattaagagcccta
tgtggacggcatacagaaaagctaatggcatttaaagcaatatacccagacattgtgcga
cttcattttcctccgttatacaaggagttgttcacttcagaatttgagccagcaatgcaa
attgatgggtaa

DBGET integrated database retrieval system