KEGG   Ursus arctos horribilis: 113270132
Entry
113270132         CDS       T05909                                 

Gene name
SYK
Definition
(RefSeq) tyrosine-protein kinase SYK
  KO
K05855  spleen tyrosine kinase [EC:2.7.10.2]
Organism
uah  Ursus arctos horribilis
Pathway
uah04064  NF-kappa B signaling pathway
uah04072  Phospholipase D signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04380  Osteoclast differentiation
uah04611  Platelet activation
uah04625  C-type lectin receptor signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah04662  B cell receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04666  Fc gamma R-mediated phagocytosis
uah05152  Tuberculosis
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    113270132 (SYK)
   04072 Phospholipase D signaling pathway
    113270132 (SYK)
   04151 PI3K-Akt signaling pathway
    113270132 (SYK)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    113270132 (SYK)
   04625 C-type lectin receptor signaling pathway
    113270132 (SYK)
   04650 Natural killer cell mediated cytotoxicity
    113270132 (SYK)
   04662 B cell receptor signaling pathway
    113270132 (SYK)
   04664 Fc epsilon RI signaling pathway
    113270132 (SYK)
   04666 Fc gamma R-mediated phagocytosis
    113270132 (SYK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113270132 (SYK)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    113270132 (SYK)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113270132 (SYK)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    113270132 (SYK)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113270132 (SYK)
   05169 Epstein-Barr virus infection
    113270132 (SYK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113270132 (SYK)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     113270132 (SYK)
Protein kinases [BR:uah01001]
 Non-receptor tyrosine kinases
  SYK family
   113270132 (SYK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 Kdo RIO1
Other DBs
NCBI-GeneID: 113270132
NCBI-ProteinID: XP_026374985
UniProt: A0A3Q7XBV3
LinkDB
Position
Unknown
AA seq 635 aa
MAGNTADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRKA
HHYTIEREMNGTYAIAGGRTHSSPAELCLYHSQESDGLVCVLKKPLHRPPGVQPKTGPFE
DLKESLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISRVESEQI
VMIGSKTNGKFLIRDRNDNGSYALCLLHEGKVLHYRIDKDKTGKLSIPDGKKFDTLWQLV
EHYSYKPDGLLRVLTVPCQKIGGQTGNINFGARAPLPGAHPATWSAGAIISRIKSYSFPK
PGHRKASSSTGNRPESSVTFNPYEPDRGPWATDRDAQREAMPMDTEVYESPYADPEEIRP
KEVYLDRKLLTLEDSELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAE
ANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSM
GMKYLEECNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADESYYKAQTHGKWPVKWYA
PECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVSAMLEKGERMGCPAGCPRE
MYELMKLCWTYEVEKRPGFENVELRLRNYYYDVVN
NT seq 1908 nt   +upstreamnt  +downstreamnt
atggcgggaaacacggccgacagcgccaaccacctgccattcttcttcggcaacatcacg
cgggaggaggcggaggactacctggtgcaggggggcatgagcgacgggctgtacctgctg
cgtcagagccgcaattacctgggcggcttcgcgctgtcggtggcgcacgggaggaaggcg
caccactacaccatcgagcgcgagatgaacggcacctacgccatcgcgggcggcaggacg
cacagcagcccggccgagctgtgcctctaccactcccaggagtccgacggcctcgtctgc
gtcctcaagaagcccctccaccggccgcctggggtgcagcccaagaccggcccgttcgag
gacctgaaggagagcctcatcagggagtacgtgaagcagacctggaacctgcagggtcag
gctctggagcaggccatcatcagccagaagcctcagctggagaagctgatcgccaccacg
gcccacgagaaaatgccctggttccacgggaaaatctcacgggttgaatctgagcaaatt
gtcatgataggatccaagacaaatggaaaatttttgatcagggacaggaacgacaacggg
tcttacgccctgtgcctgctgcacgaggggaaggtgctgcactatcgcatcgacaaggac
aaaaccgggaagctctccatccccgacgggaagaagttcgacacgctctggcagctcgtg
gagcattactcttacaaaccggacgggctgttgagagttcttacggttccgtgccagaaa
attggcgggcagacaggaaacatcaactttggagcccgcgcgcccctgccaggtgcccac
cctgcgacgtggtcagcgggcgcgataatctccagaatcaaatcctactccttcccaaag
cccggccacagaaaggcctcctcgtccacagggaaccggcccgagagctccgtgaccttc
aatccttatgagccagaccgggggccctgggccacggacagagacgcgcagagagaagcc
atgcccatggacaccgaggtgtacgaaagcccctacgccgaccccgaggagatcaggccc
aaggaggtctacctggaccgcaagctgctgaccctggaggacagtgagctgggctctggg
aacttcgggaccgtgaagaagggctactaccagatgaaaaaagtcgtgaagacagtggct
gtgaagattctgaagaacgaggccaatgaccctgctcttaaagacgagttattagcagag
gcgaacgtcatgcagcagctcgataacccttacatcgtgcgcatgatcgggatatgtgaa
gccgagtcctggatgctggtcatggagatggcggaactggggccactcaataaatactta
cagcagaacaggcacgtcaaggataagaacatcatagagctggttcatcaggtttctatg
ggaatgaaatatctggaggagtgcaattttgtgcacagagatctggctgcaagaaacgta
ttgctggttactcaacattatgccaagattagtgatttcggactttccaaagcactccgt
gctgacgaaagctactataaggcccagacccacgggaagtggccggtgaagtggtacgct
ccagagtgcattaactactacaagttctccagcaagagcgacgtctggagctttggcgtg
ctgatgtgggaggcgttctcctacggccagaagccctaccggggcatgaaaggaagtgaa
gtttcggctatgctggagaaaggggagaggatggggtgccccgcgggatgtccgagggag
atgtacgagctgatgaagctgtgctggacatatgaggtggagaagaggcccggcttcgaa
aacgtggagctgcgtctgcgcaattactactatgacgtggtgaactaa

DBGET integrated database retrieval system