KEGG   Ursus arctos horribilis: 113270160
Entry
113270160         CDS       T05909                                 

Gene name
JAK2
Definition
(RefSeq) tyrosine-protein kinase JAK2 isoform X1
  KO
K04447  Janus kinase 2 [EC:2.7.10.2]
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah04062  Chemokine signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04217  Necroptosis
uah04550  Signaling pathways regulating pluripotency of stem cells
uah04630  Jak-STAT signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04725  Cholinergic synapse
uah04917  Prolactin signaling pathway
uah04920  Adipocytokine signaling pathway
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah04935  Growth hormone synthesis, secretion and action
uah05140  Leishmaniasis
uah05145  Toxoplasmosis
uah05152  Tuberculosis
uah05161  Hepatitis B
uah05164  Influenza A
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05200  Pathways in cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113270160 (JAK2)
   04151 PI3K-Akt signaling pathway
    113270160 (JAK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113270160 (JAK2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    113270160 (JAK2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    113270160 (JAK2)
   04659 Th17 cell differentiation
    113270160 (JAK2)
   04062 Chemokine signaling pathway
    113270160 (JAK2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    113270160 (JAK2)
   04917 Prolactin signaling pathway
    113270160 (JAK2)
   04935 Growth hormone synthesis, secretion and action
    113270160 (JAK2)
  09156 Nervous system
   04725 Cholinergic synapse
    113270160 (JAK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113270160 (JAK2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113270160 (JAK2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113270160 (JAK2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113270160 (JAK2)
  09172 Infectious disease: viral
   05164 Influenza A
    113270160 (JAK2)
   05161 Hepatitis B
    113270160 (JAK2)
   05168 Herpes simplex virus 1 infection
    113270160 (JAK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113270160 (JAK2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113270160 (JAK2)
   05140 Leishmaniasis
    113270160 (JAK2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113270160 (JAK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113270160 (JAK2)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     113270160 (JAK2)
Protein kinases [BR:uah01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   113270160 (JAK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl SH2 RIO1 Kinase-like APH
Other DBs
NCBI-GeneID: 113270160
NCBI-ProteinID: XP_026375026
UniProt: A0A3Q7WQ56
LinkDB
Position
Unknown
AA seq 1132 aa
MGMACLTMTEMEGTSVSPVHQNGDIPGNANPVKDIEPLLQVYLYHSLEKAEGEYLKFPTG
EYVAEDICVAASKACGITPVYHSMFALMSETERIWYPPNHVFHIDESTRHNVLYRIRFYF
PYWYCNGSNRTYRHGISRGAEAPLLDDFVMAYLFAQWRHDFLHGWIKIPVTHETQEECLG
MAVLDMMRLAKEKDQTPLDIYSSISYKTFLPKCVRAKIQDYHILTRKRIRYRFRRFIEQF
SHCKATARNLKLKYLINLETLQSAFYTEQFEVKEPGSGPSGEEIFATIIITGNGGIQWSR
GKHKESETLTEQDLQLYCDFPDIIDVTIKQASQEGSNESRIVTIHKQDGKNLEIELSSLR
EALSFVSLIDGYYRLTADAHHYLCKEVAPPMVLENIQSNCHGPILMDFAISKLKKAGNQT
GLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENGEYNLSGTKKNFSNLKDLLNC
YQMETVRSDSIIFQFTKCCPPKLKDKSNLLVFRTNGVSDVPTSPTLQRHNNVNQMVFHKI
RNEDLMFNESLGQGTFTKIFKGIRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASM
MSQLSHKHLVLNYGVCVCGEENILVQEFVKFGSLDTYLKKNKNSINILWKLEVAKQLAWA
MHFLEEKALIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVP
PECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWTEL
ANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRD
PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIE
ILKSLQHDNIVKYKGVCYSAGRRNLRLIMEYLPYGSLRDYLQKHKERIDHKKLLQYTSQI
CKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFW
YAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIE
LLKNNGRLPRPDGCPDEIYLIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
NT seq 3399 nt   +upstreamnt  +downstreamnt
atgggaatggcttgccttacaatgacagaaatggaaggaacatccgtatctcctgtacat
cagaatggtgatattcctggaaacgctaatcccgtgaaggacatagaaccgctcctacag
gtgtatctttatcattctcttgagaaagctgaaggagagtatctgaagtttccaactggg
gagtatgttgcggaagatatttgtgttgctgcttctaaagcttgtggaatcacacctgtg
tatcatagtatgtttgctttaatgagtgaaacagaaaggatctggtatccgcccaaccat
gtcttccatatagatgagtcaaccagacacaatgtactctacagaataagattttacttt
ccttactggtattgtaatggcagcaacagaacctatcggcatggaatatctcgaggtgct
gaagctcctcttcttgacgactttgtcatggcttacctttttgctcagtggcggcatgat
tttttacatggatggataaaaatacctgtgacccatgaaacacaggaagaatgtcttgga
atggctgtgttagatatgatgagactagccaaagagaaggatcaaaccccactggacatc
tatagctctatcagctacaagacattcttaccaaaatgtgttcgagcaaagatccaagac
tatcatattttgacaaggaaacgaataaggtacaggtttcgcagatttattgagcagttc
agccattgcaaagccactgccagaaacttgaaacttaagtatcttataaatctggaaact
cttcagtctgccttctacacagagcagtttgaagtaaaagaacctggaagtggtccttca
ggtgaggagatttttgcaaccattataataactggaaacggtggaattcagtggtcaaga
gggaaacataaagaaagtgagacactgacagaacaggatttacagttatattgtgacttt
cctgatattattgatgttactattaagcaagcaagccaagaaggctcaaatgaaagtaga
attgtaactatccataagcaagatggtaaaaacctggaaattgaacttagctcattaaga
gaagctttgtcctttgtgtcattaattgatggctattatagattaactgcagacgcacat
cattacctctgtaaagaagtagcacctccaatggtccttgaaaatatacaaagcaactgt
catggcccaattttaatggatttcgccatcagtaaactgaagaaagcaggtaatcagact
ggactctatgtacttcgatgcagtcctaaggactttaataagtattttctgacttttgct
gtcgagcgagaaaatgtcattgaatataagcactgtttgattacgaaaaatgagaatgga
gaatacaacctcagtggaaccaagaagaacttcagtaatcttaaagatcttttgaattgc
taccaaatggaaactgttcgctcagacagtataattttccagtttactaaatgctgtccc
ccaaagttgaaagataaatcaaaccttctggtcttcagaaccaatggtgtttctgatgtt
ccaacatcaccaacattacagaggcataataatgtgaaccaaatggtgtttcacaaaatc
agaaatgaagatttgatgtttaatgaaagccttggtcaaggcacttttacaaaaattttt
aaaggtataagaagagaagtaggagactatggtcaactccatgaaacagaagttctttta
aaagttctggataaagcacacagaaactactcagagtctttctttgaagcagcaagcatg
atgagccagctttctcacaagcatctggttttaaattatggagtatgtgtctgtggggag
gagaatattctggttcaagagtttgtaaaatttggatcattagatacatatctgaaaaag
aataaaaattctataaatatattatggaaacttgaagtggctaaacagttggcatgggcc
atgcattttctagaagaaaaagcacttattcatggaaatgtgtgtgccaaaaatattctg
cttatcagagaagaagacaggaagacaggaaatcctcctttcatcaaacttagtgatcct
ggcattagtattacagttttgccaaaggacattcttcaggagagaataccatgggtacca
cctgaatgcattgaaaatcctaaaaatctaaatttggcaacagacaaatggagttttggt
accactttgtgggaaatctgcagtggaggagataagcctctgagtgctttggattctcaa
agaaagctacagttttatgaagataggcaccagcttcctgcaccaaagtggacagaatta
gcaaatcttattaataattgtatggattatgaaccagattttagaccttctttcagagcc
atcatacgagatcttaatagtttgtttactccagattatgaactattaacagaaaatgac
atgttaccaaatatgagaataggtgccctagggttttccggtgcttttgaagaccgagac
cctacacagtttgaagagagacacttgaaatttctacagcaacttggcaagggtaatttt
ggcagtgtggagatgtgccggtatgaccctctgcaagacaacactggggaggtggtggct
gtgaagaagctccagcacagtactgaagagcacctgagagactttgaaagggaaattgaa
atcctcaaatcgctgcagcatgacaacattgtaaagtacaagggagtgtgctacagtgct
ggtcggcgtaatctaagattaattatggaatatttaccatatggaagtttacgagactat
ctccaaaaacataaagaacggatagatcataaaaaacttctgcagtatacatctcagata
tgcaagggcatggagtatcttggtacaaaaaggtatatccacagggatctggcaacaagg
aatatattggtggaaaacgaaaacagagttaaaattggagattttgggttaaccaaagtc
ttgccacaagacaaagaatattacaaagtaaaagaacctggtgaaagtcccatattctgg
tatgctccggaatcactgacggagagcaagttttctgtggcttcagatgtctggagcttt
ggagtggttctgtatgaacttttcacgtatattgagaagagtaaaagtcccccagcggaa
tttatgcgtatgattggcaatgacaaacaaggacagatgattgtgtttcatttgatagaa
ctcctaaagaataatggaagattaccaagaccagatggatgcccagatgagatttatttg
atcatgacagaatgctggaacaataatgtcaatcaacgcccctcttttagagacctagct
cttcgagttgatcaaataagggacaacatggctggatga

DBGET integrated database retrieval system