KEGG   Ursus arctos horribilis: 113270476
Entry
113270476         CDS       T05909                                 

Gene name
CASP9
Definition
(RefSeq) caspase-9 isoform X1
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
uah  Ursus arctos horribilis
Pathway
uah01524  Platinum drug resistance
uah04115  p53 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04210  Apoptosis
uah04215  Apoptosis - multiple species
uah04370  VEGF signaling pathway
uah04919  Thyroid hormone signaling pathway
uah05010  Alzheimer disease
uah05012  Parkinson disease
uah05014  Amyotrophic lateral sclerosis (ALS)
uah05016  Huntington disease
uah05134  Legionellosis
uah05145  Toxoplasmosis
uah05152  Tuberculosis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05210  Colorectal cancer
uah05212  Pancreatic cancer
uah05213  Endometrial cancer
uah05215  Prostate cancer
uah05222  Small cell lung cancer
uah05223  Non-small cell lung cancer
uah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    113270476 (CASP9)
   04151 PI3K-Akt signaling pathway
    113270476 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    113270476 (CASP9)
   04215 Apoptosis - multiple species
    113270476 (CASP9)
   04115 p53 signaling pathway
    113270476 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    113270476 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113270476 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113270476 (CASP9)
   05212 Pancreatic cancer
    113270476 (CASP9)
   05215 Prostate cancer
    113270476 (CASP9)
   05213 Endometrial cancer
    113270476 (CASP9)
   05222 Small cell lung cancer
    113270476 (CASP9)
   05223 Non-small cell lung cancer
    113270476 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113270476 (CASP9)
   05012 Parkinson disease
    113270476 (CASP9)
   05014 Amyotrophic lateral sclerosis (ALS)
    113270476 (CASP9)
   05016 Huntington disease
    113270476 (CASP9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    113270476 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    113270476 (CASP9)
   05152 Tuberculosis
    113270476 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113270476 (CASP9)
   05162 Measles
    113270476 (CASP9)
   05164 Influenza A
    113270476 (CASP9)
   05161 Hepatitis B
    113270476 (CASP9)
   05160 Hepatitis C
    113270476 (CASP9)
   05168 Herpes simplex virus 1 infection
    113270476 (CASP9)
   05163 Human cytomegalovirus infection
    113270476 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113270476 (CASP9)
   05169 Epstein-Barr virus infection
    113270476 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113270476 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    113270476 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:uah01009]
    113270476 (CASP9)
   01002 Peptidases and inhibitors [BR:uah01002]
    113270476 (CASP9)
Enzymes [BR:uah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     113270476 (CASP9)
Protein phosphatases and associated proteins [BR:uah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     113270476 (CASP9)
Peptidases and inhibitors [BR:uah01002]
 Cysteine peptidases
  Family C14: caspase family
   113270476 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 113270476
NCBI-ProteinID: XP_026375570
UniProt: A0A3Q7XDF4
LinkDB
Position
Unknown
AA seq 451 aa
MDEADRQLLRRCRVRLVTELQVASLWDVLLTRQLFTPAMIEDIQHAGSGSRSDQARQLVI
DLETRGSQALPLFISCLEDTDQDKLASLLRMSRQAEKQNPEAVRPLNLMPVVLGPTGLTP
EDLREKHGPSKPTPGKLAPVVLGPEQLWPDKLRPEVLRSEVSRPVDSGSGRFSDVCAQEI
SKQNVDLAYALNTDPCGHCLIINNVNFCLESRLTTRAGSNIDCEKLRRRFRLLHFTVEVK
CDLTAKQMLQALVELARRDHGALDCCVVVVLSHGCQASHRQFPGAVYGTDGCPVSVEKIV
NIFNGAGCPSLGGKPKLFFIQACGGEQKDHGFQVASASPEDRTPDSDPESDAVPFQEGPG
PFDQPDAVSSLPTPSDIFVSYSTFPGFVSWRDTKSGSWYVETLDGVFEQWADSEDLQTLL
LRVANAVSQKGIYKQIPGCFNFLRKKLFFKT
NT seq 1356 nt   +upstreamnt  +downstreamnt
atggacgaggccgaccggcagctcctgcgccggtgccgggtgcggctggtcaccgagctg
caggtggcctcgctctgggacgttctgctcacccgccagctcttcacgcccgccatgatc
gaggacattcagcatgcaggctcagggtctcggagcgatcaggccaggcagctggtcata
gatctagagacccgagggagtcaggccctccctttgttcatctcctgcttagaggacaca
gaccaggataagctggcttcattgctgagaatgagtcggcaagcagaaaagcagaatcca
gaggctgtcagacccctgaacctcatgcctgtggtgcttggaccaacgggcctcacacca
gaggatctcagagagaagcacggtccatcaaagccgactccaggaaaactcgctccagtg
gtgctggggcctgagcagctctggccagacaagctcaggccagaggttctcagatcagag
gtgtccaggccagtggacagtggttctggacgattcagtgatgtctgtgctcaggagatt
tccaagcaaaatgttgatttggcgtacgccctgaacacagacccctgcggccactgcctc
atcatcaacaacgtgaacttctgcctcgagtcgaggctcacgacccgcgccggctccaat
atcgactgtgagaagctgcgtcggcgcttccgcttgctgcatttcacggtggaggtgaag
tgcgacctgacggccaagcaaatgctccaggctttggtggagctggcgcggcgcgaccac
ggtgccctggactgctgcgtggtggtcgtcctctctcacggctgtcaggccagccaccgc
cagttcccaggggctgtttatggcacggatggatgtcctgtgtctgtcgagaaaattgtg
aacatcttcaatggagccggctgccccagcttgggagggaagcccaagctcttcttcatc
caggcctgtggtggggagcagaaagaccatggatttcaggtggcctctgcttcccccgaa
gacaggacccctgacagtgaccccgagtccgacgctgtcccgttccaggaaggcccaggc
ccctttgaccagccggacgccgtgtctagtttgcccacacccagtgacatctttgtgtcc
tactccaccttcccaggctttgtttcctggagggataccaagagcggctcctggtacgtg
gagaccttggacggtgtttttgagcagtgggctgactctgaggacctgcagaccctcctg
ctcagggtcgctaatgccgtttcgcagaaagggatttacaaacagattcccggttgtttc
aatttcctccggaaaaaacttttttttaaaacgtaa

DBGET integrated database retrieval system