KEGG   Ursus arctos horribilis: 113270510
Entry
113270510         CDS       T05909                                 

Gene name
MTOR
Definition
(RefSeq) serine/threonine-protein kinase mTOR
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah01522  Endocrine resistance
uah04012  ErbB signaling pathway
uah04066  HIF-1 signaling pathway
uah04072  Phospholipase D signaling pathway
uah04136  Autophagy - other
uah04140  Autophagy - animal
uah04150  mTOR signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04152  AMPK signaling pathway
uah04211  Longevity regulating pathway
uah04213  Longevity regulating pathway - multiple species
uah04218  Cellular senescence
uah04371  Apelin signaling pathway
uah04630  Jak-STAT signaling pathway
uah04659  Th17 cell differentiation
uah04714  Thermogenesis
uah04910  Insulin signaling pathway
uah04919  Thyroid hormone signaling pathway
uah04920  Adipocytokine signaling pathway
uah04930  Type II diabetes mellitus
uah04931  Insulin resistance
uah04935  Growth hormone synthesis, secretion and action
uah05010  Alzheimer disease
uah05016  Huntington disease
uah05017  Spinocerebellar ataxia
uah05163  Human cytomegalovirus infection
uah05165  Human papillomavirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05205  Proteoglycans in cancer
uah05206  MicroRNAs in cancer
uah05210  Colorectal cancer
uah05212  Pancreatic cancer
uah05214  Glioma
uah05215  Prostate cancer
uah05221  Acute myeloid leukemia
uah05224  Breast cancer
uah05225  Hepatocellular carcinoma
uah05226  Gastric cancer
uah05230  Central carbon metabolism in cancer
uah05231  Choline metabolism in cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    113270510 (MTOR)
   04371 Apelin signaling pathway
    113270510 (MTOR)
   04630 Jak-STAT signaling pathway
    113270510 (MTOR)
   04066 HIF-1 signaling pathway
    113270510 (MTOR)
   04072 Phospholipase D signaling pathway
    113270510 (MTOR)
   04151 PI3K-Akt signaling pathway
    113270510 (MTOR)
   04152 AMPK signaling pathway
    113270510 (MTOR)
   04150 mTOR signaling pathway
    113270510 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113270510 (MTOR)
   04136 Autophagy - other
    113270510 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    113270510 (MTOR)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    113270510 (MTOR)
  09152 Endocrine system
   04910 Insulin signaling pathway
    113270510 (MTOR)
   04920 Adipocytokine signaling pathway
    113270510 (MTOR)
   04935 Growth hormone synthesis, secretion and action
    113270510 (MTOR)
   04919 Thyroid hormone signaling pathway
    113270510 (MTOR)
  09149 Aging
   04211 Longevity regulating pathway
    113270510 (MTOR)
   04213 Longevity regulating pathway - multiple species
    113270510 (MTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    113270510 (MTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113270510 (MTOR)
   05206 MicroRNAs in cancer
    113270510 (MTOR)
   05205 Proteoglycans in cancer
    113270510 (MTOR)
   05230 Central carbon metabolism in cancer
    113270510 (MTOR)
   05231 Choline metabolism in cancer
    113270510 (MTOR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113270510 (MTOR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113270510 (MTOR)
   05212 Pancreatic cancer
    113270510 (MTOR)
   05225 Hepatocellular carcinoma
    113270510 (MTOR)
   05226 Gastric cancer
    113270510 (MTOR)
   05214 Glioma
    113270510 (MTOR)
   05221 Acute myeloid leukemia
    113270510 (MTOR)
   05215 Prostate cancer
    113270510 (MTOR)
   05224 Breast cancer
    113270510 (MTOR)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113270510 (MTOR)
   05016 Huntington disease
    113270510 (MTOR)
   05017 Spinocerebellar ataxia
    113270510 (MTOR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    113270510 (MTOR)
   04931 Insulin resistance
    113270510 (MTOR)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113270510 (MTOR)
   05168 Herpes simplex virus 1 infection
    113270510 (MTOR)
   05163 Human cytomegalovirus infection
    113270510 (MTOR)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113270510 (MTOR)
   05165 Human papillomavirus infection
    113270510 (MTOR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113270510 (MTOR)
   01522 Endocrine resistance
    113270510 (MTOR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113270510 (MTOR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113270510 (MTOR)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113270510 (MTOR)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   113270510 (MTOR)
Membrane trafficking [BR:uah04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    113270510 (MTOR)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 V-ATPase_H_N UME EPSP_synthase HEAT_EZ Nipped-B_C
Other DBs
NCBI-GeneID: 113270510
NCBI-ProteinID: XP_026375641
UniProt: A0A3Q7WRZ8
LinkDB
Position
Unknown
AA seq 2550 aa
MLGTGPAAATAATTTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPPQSNALVGLLGYSSHQGLMGFGASPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTALPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSVHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEVPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRPTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTVQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITSTTTAATTAATATATATSTEGSNSESEAESTENS
PTPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDV
NEALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVA
SKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYF
GERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQ
AWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPS
LQVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKN
LSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLT
LMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDR
HPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRIT
CHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILD
GVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDETL
DVPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7653 nt   +upstreamnt  +downstreamnt
atgctgggaactggacccgctgccgccaccgcagctaccaccacgtccagcaacgtgagc
gtcctgcagcagttcgccagtggcctgaagagccggaatgaggagaccagggccaaagct
gccaaggagctccagcactatgtcaccatggagcttcgagagatgagtcaagaggagtct
actcgattctatgatcagctgaaccatcatatttttgaactggtttccagctcagatgcc
aatgagaggaaaggtggcatcttggccatagccagcctcataggagtggaaggcgggaat
gccactcggattggcagattcgctaactatcttcggaacctcctcccctcgaatgaccca
gttgtcatggagatggcatccaaggccattggccgcctcgccatggcaggggacactttt
acggctgagtatgtggagtttgaggtgaagcgagccttggagtggctgggcgccgaccgc
aacgagggccggagacacgccgctgttctggttctccgtgagctggccatcagcgtcccc
accttcttcttccagcaagtgcagcccttctttgacaacatttttgtggccgtgtgggac
cccaaacaggccatccgtgagggagccgtggccgcccttcgtgcctgcctgattctcacc
actcagcgtgagccgaaggagatgcagaagcctcagtggtaccggcatacgtttgaagaa
gcagagaaagggtttgatgagacgttggccaaggagaaaggcatgaatcgggatgatcgc
atccatggagccttgctgatcctcaacgagttggtccgaatcagcagcatggagggagag
cgcctgagagaagaaatggaagaaatcacacagcagcagctcgtgcatgacaagtactgc
aaggacctcatgggctttgggacgaaacctcgccacattacccccttcaccagtttccag
gccgtccagcccccgcagtccaatgccttggtgggactgctggggtacagctctcaccaa
ggcctcatggggttcggggcttcccccagcccagcgaagtccaccctggtggagagtcgg
tgttgcagagacctgatggaggagaaatttgatcaagtgtgccagtgggtgctgaaatgc
aggaacagcaagaactcgctgatccagatgacaatccttaatctgttgccccgcctggcc
gcgtttcgaccttccgccttcacagatacccagtacctccaagataccatgaaccatgtc
ttaagctgtgtcaagaaggagaaggaacgtacagcagccttccaagccctggggctgctt
tctgtggctgtgagatctgaatttaaggtctatttacctcgtgtgctggacatcatccgt
gcagccctaccccctaaggactttgcccataagagacagaaggccatgcaggtggatgcc
acagtgttcacctgcatcagcatgctggcccgggcaatggggccaggcatccaacaggat
atcaaggagctgctggagcccatgctggcagtgggactgagccctgccctcactgctgtg
ctgtacgacctgagccgtcagattccgcagctgaagaaggacatccaggatgggctcctg
aagatgctgtccctggtcctgatgcacaaacccctccggcatccgggcatgcccaagggc
ctggcccatcagctagcttcccctggcctcacagccctgcctgaggccagcgatgtcggc
agcattactcttgccctgcgaacacttggcagctttgaatttgaaggccactctctgacc
cagttcgtccgccactgtgcggatcatttcctaaacagcgagcacaaggagatccgcatg
gaagctgcccgcacctgctcccgcctgctcacgccctctgtccacctcatcagtggccac
gctcacgtggttagccagactgcagtacaagtggtggcagacgtgctcagcaagctgctc
gtggttgggataacagatcctgaccctgacatccgctactgtgtcttggcatccctggat
gagcgctttgatgcacacctggcccaggcagagaatttgcaggccctgtttgtggccctg
aacgaccaggtgtttgagatccgggagctggccatctgcaccgtgggccggctcagtagc
atgaacccagccttcgtcatgcctttcctgcgcaagatgcttatccagattttgacggag
ctggagcacagcggcattggaagaatcaaagagcaaagtgcccgcatgctgggacacctc
gtctccaatgcaccccggctcatccgcccctacatggagcccattctgaaggctttaatt
ttgaaactgaaagatccggaccctgatccaaacccaggtgtgatcaataatgtcttagct
acaataggagaattggctcaggttagtggcctagaaatgaggaagtgggtggatgaactc
tttattatcatcatggacatgctccaggactcctcgctgttggccaaaaggcaggtggct
ctgtggaccctgggacagttggtggccagcactggctatgtagtggagccctacaggaag
taccccactctgcttgaggtcctgctgaattttctgaagactgagcagaaccagggtaca
cggagagaggctatccgtgtgttggggcttttgggggccctggatccctacaagcacaaa
gtaaacattggcatgattgaccagtcccgcgacgcttctgctgtcagcctgtctgaatcc
aagtcaagtcaggattcctcggactacagcaccagcgagatgctggtcaacatgggcaac
ctgcccctggatgagttctaccctgctgtgtccatggtggcgctgatgcggatcttccga
gaccagtccctctcgcaccatcacaccatggttgtccaggccatcaccttcatcttcaag
tctctgggcctcaagtgtgtgcagttcctgccgcaggtcatgcccacattcctcaatgtc
attcgggtctgtgatggggccatccgggaattcctgttccagcagctgggaatgctggtg
tcctttgtgaagagccacatccgaccttacatggatgaaatagtcaccctcatgagagaa
ttctgggtcatgaacacctcgatccagagcacaatcatccttctcattgagcaaatagtg
gtagctcttgggggtgaatttaagctctacctgccccagctgatcccacacatgctacgc
gtcttcatgcatgacaacagcccaggccgcatcgtctccatcaagctgttggccgccatc
cagctgtttggcgccaacctggatgactatctgcatttgttgttgccccctatcgtgaag
ctgtttgacgccccagaagtccccctgccatctcggaaggcagcattagagacagtggac
cgcctgacagagtccctggacttcactgactacgcctcccggatcattcatccgattgtt
cgaacgctggaccagagcccggaactgcgtcccacggccatggacacgttgtcttcgctg
gtcttccagctggggaagaagtaccaaattttcattccaatggtgaataaagtcctggtg
cgacaccgaatcaaccatcagcgctacgacgtcctcatctgcagaatcgtcaagggatac
acccttgctgatgaagaagaggaccctttgatttaccagcatcgaatgctgaggagtggc
cagggggatgcgttggctagtgggccagtagaaacagggcccatgaagaaactgcatgtc
agcaccatcaacctccaaaaggcctggggagctgccagaagggtctccaaagatgactgg
ctggaatggctgaggcggctgagtctggagctcctgaaggactcctcgtcgccttccctg
cgctcgtgctgggccctggctcaggcctacaacccaatggccagggatctttttaatgcc
gcatttgtgtcctgctggtctgaactgaatgaagaccagcaggatgaactcatcagaagc
atcgagttggccctcacctcgcaggacatcgctgaagtcacgcagaccctcttaaacttg
gctgaattcatggaacacagtgacaagggccctctgccattgagagacgacaatggcatc
gtcctgctgggtgagagggctgccaagtgccgagcatatgccaaagcactccactacaaa
gaactggagttccagaaaggtcccacccctgccatcctagagtctctcatcagcattaat
aataagctccagcagccggaggcagccgcgggggtgttagagtatgccatgaaacacttc
ggagagctggagatccaggctacctggtacgagaaactgcacgagtgggaggacgcgctc
gtggcctacgacaagaagatggacaccaacaaggatgatccggagctgatgctgggccgc
atgcgctgcctcgaggccctgggggaatggggccagctccaccagcagtgctgtgaaaag
tggaccctggttaatgatgagacccaagccaagatggcccgcatggctgccgcagctgcg
tggggtttaggtcagtgggacagcatggaggagtatacctgtatgatccctcgggacacc
cacgatggggcattttacagagccgtgctggcactgcatcaggacctcttctccttggcg
caacagtgcatcgacaaagccagagacctgctggatgccgagttaaccgctatggcagga
gagagctacagtcgggcatatggggccatggtctcttgccacatgctctccgagctggag
gaggttatccagtacaaacttgtccccgagcgacgggagatcatccgccagatctggtgg
gagagactgcagggctgccagcgtattgtggaggactggcagaaaatcctgatggtgcgg
tcgctcgtggtcagccctcatgaggatatgaggacctggctcaagtatgccagcctgtgc
gggaagagtggcaggctggcccttgctcataaaaccttagtgttgctcctgggagttgat
ccatctcggcaacttgaccaccctctgccaacagttcaccctcaggtgacctacgcctac
atgaaaaacatgtggaagagcgctcgcaagatcgacgcctttcagcacatgcagcacttc
gtgcagaccgtgcagcagcaggcccagcacgccatcgccaccgaggaccagcagcacaag
caagagctgcacaagctcatggcccggtgcttcctgaagctcggggagtggcagctgaac
ctgcagggcatcaacgagagcaccatccccaaagtgctgcagtactacagcgcggccacg
gagcacgaccgcagctggtacaaggcctggcacgcgtgggcagtgatgaactttgaggct
gtgctgcactacaaacatcagaaccaagcccgggacgagaagaagaagctgcggcacgcc
agcggggccaacatcaccagcacgaccactgccgccaccacagcggccaccgccaccgcc
accgccaccagcaccgagggcagcaacagcgagagtgaggccgagagcaccgagaacagc
cccaccccatctcccctgcagaagaaggtcactgaggatttatccaaaaccctcttgatg
tacaccgtccctgcggtccagggcttcttccgttccatctccttgtcacgaggcaacaac
ctccaggacacgctgagagtcctcaccttatggtttgactatggtcactggccagacgta
aatgaagccttagtggagggggtgaaagcaattcagattgacacttggttacaggttata
ccgcagctcatcgcaaggatcgatactcctaggcccttggtgggccgcctcattcaccag
cttctcactgacattggccggtaccacccgcaggccctcatctaccccctgaccgtggcc
tctaagtccaccacgacggcccgccacaacgcagccaacaagattctgaagaacatgtgc
gagcacagtaacaccctggtccagcaggccatgatggtgagtgaggagctaatccgcgtg
gccatcctctggcacgagatgtggcacgaaggcctggaagaagcgtctcgtttgtacttt
ggggaaaggaacgtgaaaggcatgtttgaggtgctggagcccctgcatgctatgatggaa
cggggcccccagactctgaaggaaacatcttttaatcaggcatatggtcgagacttaatg
gaggcccaagagtggtgcaggaagtacatgaaatccggaaacgtcaaggacctcacccaa
gcctgggacctctattatcacgtgttcagacgaatctcgaagcagctgcctcagctcacc
tccttagaactgcagtatgtttcccccaaacttctgatgtgccgggaccttgaattggct
gtgccagggacgtacgaccccaaccagccgatcattcgcattcagtccatagcgccgtcc
ctgcaggtcatcacctccaagcagaggccccggaagctgacgctcatgggcagcaacggg
catgagtttgttttcctcctgaagggccatgaagacctgcggcaggatgagcgagtgatg
cagctctttggcctggtgaacacccttctggccaacgacccaacgtctcttcgcaagaac
ctcagcatccagagatacgctgtcatccccttatcaaccaactcgggcctcatcggctgg
gtcccccactgcgacacgctgcacgccctcatccgggactacagagagaagaagaagatc
cttctcaacatcgagcatcgcatcatgttgcggatggcaccggactacgatcacctgacg
ctgatgcagaaggtggaggtgttcgagcacgccgtcaataacacggccggcgacgacctg
gccaagctgctgtggctgaagagccccagctccgaggtgtggtttgaccgaagaaccaac
tatacccgctctttagcggtcatgtccatggttgggtatattttgggcctgggagatcga
cacccatccaacctaatgctggaccggctgagtgggaagatcctgcacatcgactttggg
gactgctttgaggttgctatgaccagggagaaattcccagagaagattccatttagacta
acaagaatgctgaccaatgctatggaggttactggtctggatggcaactatagaatcacg
tgccacacggtgatggaagtgcttcgggaacacaaggatagtgtcatggccgtgctggaa
gcctttgtctatgaccccttgctgaactggaggctgatggacacaaataccaaaggcaac
aagcggtcccgaacaaggacggattcctactctgctggccagtcagtagaaattttggat
ggtgtggaacttggggaacctgcccataagaaaacggggaccacagtgccagaatctatt
cattctttcattggagacggtttggtgaaaccagaggccctaaataagaaagctattcaa
attattaacagggttcgagacaagctcactggtcgggacttttctcatgacgaaaccctg
gatgtcccaacacaggtggagctgctcatcaaacaagcaacgtcccacgagaacctctgt
caatgctacatcggctggtgtcctttctggtaa

DBGET integrated database retrieval system