KEGG   Ursus arctos horribilis: 113270606
Entry
113270606         CDS       T05909                                 

Gene name
TNFRSF14
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 14 isoform X1
  KO
K05152  tumor necrosis factor receptor superfamily member 14
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113270606 (TNFRSF14)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113270606 (TNFRSF14)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    113270606 (TNFRSF14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113270606 (TNFRSF14)
   04090 CD molecules [BR:uah04090]
    113270606 (TNFRSF14)
Cytokine receptors [BR:uah04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   113270606 (TNFRSF14)
CD molecules [BR:uah04090]
 Proteins
  113270606 (TNFRSF14)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 113270606
NCBI-ProteinID: XP_026375817
UniProt: A0A3Q7Y9D1
LinkDB
Position
Unknown
AA seq 280 aa
MEPLRGWEPPPWSLTPKADALHQALYLLLLGSLPCALAMAPCKEEEYPVGSECCPKCSPG
YRVKEACGELTGTLCVPCDPGTYTAHLNGLSECLQCRVCDPALGLVTRQKCSRTENTVCV
CDQGHFCISEDGDDCAECRPHTLCRPGQRVRARGTERQDRVCEDCPSGTFSPSGTLEECQ
PWTTCSGPFQTEAEPGTSSSDITCSSRGLYVFVGSLVLIGVLCGLIVLGIRMKNRRSPGG
PTKARLFHQVPRAPPDITTVALEETASVSPVSLPCVTGRE
NT seq 843 nt   +upstreamnt  +downstreamnt
atggagcctcttcgaggctgggagccgcccccctggagcctgacacccaaggctgatgcc
ctgcaccaggccctgtacctgcttctcctggggtccctcccctgtgctctggccatggcc
ccgtgcaaagaggaggagtacccagtagggtccgaatgctgtcccaagtgcagcccaggt
tacagggtgaaggaggcctgtggggagctgacgggcacactgtgtgttccctgtgacccg
gggacctacacggcccacctcaacggcctgagtgagtgtctgcagtgccgagtgtgtgac
ccagccttgggcctggtgaccagacagaagtgctcccggacagagaacactgtgtgtgtc
tgcgaccagggccacttctgcatcagtgaggatggggacgactgtgcagagtgccgcccg
cacacgctctgcagacctggccagagggtgcgggccagaggcacagagcggcaggacagg
gtgtgtgaagactgcccttccgggaccttctcacccagcgggaccctggaggagtgccag
ccctggaccacgtgcagcggccctttccagacagaagcagagcctgggaccagcagctcg
gatatcacatgttcctccaggggcctttatgtttttgtgggcagtctcgtccttataggg
gttctctgtggcctcatagtcctcgggataaggatgaaaaacagacggtcgcctggggga
cccaccaaggcgagattatttcaccaggtcccgcgggccccaccagacatcaccacggtg
gctttggaggagacagcgtctgtgtcccctgtgtccctcccctgtgtcactgggagggaa
tga

DBGET integrated database retrieval system