KEGG   Ursus arctos horribilis: 113271152
Entry
113271152         CDS       T05909                                 

Gene name
TP53
Definition
(RefSeq) cellular tumor antigen p53
  KO
K04451  tumor protein p53
Organism
uah  Ursus arctos horribilis
Pathway
uah01522  Endocrine resistance
uah01524  Platinum drug resistance
uah04010  MAPK signaling pathway
uah04071  Sphingolipid signaling pathway
uah04110  Cell cycle
uah04115  p53 signaling pathway
uah04137  Mitophagy - animal
uah04151  PI3K-Akt signaling pathway
uah04210  Apoptosis
uah04211  Longevity regulating pathway
uah04216  Ferroptosis
uah04218  Cellular senescence
uah04310  Wnt signaling pathway
uah04722  Neurotrophin signaling pathway
uah04919  Thyroid hormone signaling pathway
uah05012  Parkinson disease
uah05014  Amyotrophic lateral sclerosis (ALS)
uah05016  Huntington disease
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05200  Pathways in cancer
uah05202  Transcriptional misregulation in cancer
uah05203  Viral carcinogenesis
uah05205  Proteoglycans in cancer
uah05206  MicroRNAs in cancer
uah05210  Colorectal cancer
uah05212  Pancreatic cancer
uah05213  Endometrial cancer
uah05214  Glioma
uah05215  Prostate cancer
uah05216  Thyroid cancer
uah05217  Basal cell carcinoma
uah05218  Melanoma
uah05219  Bladder cancer
uah05220  Chronic myeloid leukemia
uah05222  Small cell lung cancer
uah05223  Non-small cell lung cancer
uah05224  Breast cancer
uah05225  Hepatocellular carcinoma
uah05226  Gastric cancer
uah05230  Central carbon metabolism in cancer
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113271152 (TP53)
   04310 Wnt signaling pathway
    113271152 (TP53)
   04071 Sphingolipid signaling pathway
    113271152 (TP53)
   04151 PI3K-Akt signaling pathway
    113271152 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    113271152 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    113271152 (TP53)
   04210 Apoptosis
    113271152 (TP53)
   04216 Ferroptosis
    113271152 (TP53)
   04115 p53 signaling pathway
    113271152 (TP53)
   04218 Cellular senescence
    113271152 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    113271152 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    113271152 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    113271152 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113271152 (TP53)
   05202 Transcriptional misregulation in cancer
    113271152 (TP53)
   05206 MicroRNAs in cancer
    113271152 (TP53)
   05205 Proteoglycans in cancer
    113271152 (TP53)
   05203 Viral carcinogenesis
    113271152 (TP53)
   05230 Central carbon metabolism in cancer
    113271152 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113271152 (TP53)
   05212 Pancreatic cancer
    113271152 (TP53)
   05225 Hepatocellular carcinoma
    113271152 (TP53)
   05226 Gastric cancer
    113271152 (TP53)
   05214 Glioma
    113271152 (TP53)
   05216 Thyroid cancer
    113271152 (TP53)
   05220 Chronic myeloid leukemia
    113271152 (TP53)
   05217 Basal cell carcinoma
    113271152 (TP53)
   05218 Melanoma
    113271152 (TP53)
   05219 Bladder cancer
    113271152 (TP53)
   05215 Prostate cancer
    113271152 (TP53)
   05213 Endometrial cancer
    113271152 (TP53)
   05224 Breast cancer
    113271152 (TP53)
   05222 Small cell lung cancer
    113271152 (TP53)
   05223 Non-small cell lung cancer
    113271152 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    113271152 (TP53)
   05014 Amyotrophic lateral sclerosis (ALS)
    113271152 (TP53)
   05016 Huntington disease
    113271152 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113271152 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113271152 (TP53)
   05162 Measles
    113271152 (TP53)
   05161 Hepatitis B
    113271152 (TP53)
   05160 Hepatitis C
    113271152 (TP53)
   05168 Herpes simplex virus 1 infection
    113271152 (TP53)
   05163 Human cytomegalovirus infection
    113271152 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113271152 (TP53)
   05169 Epstein-Barr virus infection
    113271152 (TP53)
   05165 Human papillomavirus infection
    113271152 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    113271152 (TP53)
   01522 Endocrine resistance
    113271152 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:uah03000]
    113271152 (TP53)
   03036 Chromosome and associated proteins [BR:uah03036]
    113271152 (TP53)
   03400 DNA repair and recombination proteins [BR:uah03400]
    113271152 (TP53)
Transcription factors [BR:uah03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    113271152 (TP53)
Chromosome and associated proteins [BR:uah03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     113271152 (TP53)
DNA repair and recombination proteins [BR:uah03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    113271152 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD
Other DBs
NCBI-GeneID: 113271152
NCBI-ProteinID: XP_026376674
UniProt: A0A3Q7Y5W2
LinkDB
Position
Unknown
AA seq 381 aa
MQDPQSELTIDPPLSQETFSELWNLLPENNVLSSELSPGVDELLLSEGVVNWMDEGSDDT
PRMPVAPAPAAPGPAISWPLSSSVPSPKTYPGTYGFRLGFLHSGTAKSVTCTYSPSLNKL
FCQLAKTCPVQLWVNSPPPPDTCVRAMAIYKKSEFVTEVVRRCPHHERCSDGSDGLAPPQ
HLIRVEGNLRAKYLDDRNTFRHSVVVPYEPPEVGSDCTTVHYNYMCNSSCMGGMNRRPIL
TIITLEDSSGNVLGRSSFEVRVCACPGRDRRTEEENFRKKGESSPEPPPGSTKRALPPST
SCSPPQKKKPLDGEYFTLQIRGRERFNMFRELNEALELKDALSGKEPGGSRAHSSHLKAK
KGQSTSRHKKLMFKREGPDSD
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgcaggacccgcagtcggagctcaccatcgacccccctctgagccaggagacattttcc
gaattgtggaatctgcttcctgaaaacaatgttctgtcttccgagctgtccccaggagtg
gatgaactgctgctctcagaaggcgtcgtgaactggatggacgaaggttcagatgacact
cccaggatgccagtggctcccgcccctgcggcccctggaccagccatctcctggcccctg
tcatcctctgtcccttccccgaagacctaccctggcacctatgggttccgtctggggttc
ctgcattccgggacagccaagtctgttacttgcacgtactccccctccctcaacaagctg
ttttgccagctggcaaagacctgccccgtgcagctgtgggtcaactccccgcccccaccc
gacacctgtgtccgcgccatggccatttataagaagtcggagttcgtgacagaggttgtg
cggcgctgtccccaccacgagcgctgctctgatggtagtgatgggctggccccgcctcag
catctcatccgggtggaaggaaacttgcgtgccaagtacttggacgacagaaacactttc
cgacatagcgtggtggtgccctatgagccgcccgaggtcggctctgactgtaccacagtc
cactataactacatgtgtaacagttcctgcatgggaggcatgaaccggcggcccatcctc
accatcatcaccctggaagattccagtggtaatgttctcggacggagcagctttgaggta
cgcgtctgtgcctgtcctgggagagaccggcgcacagaggaggagaatttccgtaagaag
ggggagtcttcccccgagccgccccccggaagcactaagcgagcactgcctcccagcacc
agctgctctcccccacaaaagaagaagccactggatggggaatatttcacccttcagatc
cgtgggcgtgaacgcttcaatatgttcagggagctgaatgaggccttggagctgaaggat
gccctgagtggcaaggagccaggggggagcagggctcactccagccacctgaaggctaag
aaggggcaatctacctcccgccataaaaagctgatgttcaagagagagggacccgactca
gactga

DBGET integrated database retrieval system